Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Helicobacter pylori ftnA/pfr Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
Uniprot ID:
Q9ZLI1
Molecular weight:
21.31 kDa

Original price was: €294.00.Current price is: €230.00.

50ug 22% OFF + 230 loyalty points
Asp5–Ser167
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Helicobacter pylori ftnA/pfr Protein, N-His

Product name ARO-P11552-100
Uniprot ID Q9ZLI1
Origin species Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
Expression system Prokaryotic expression
Raw Antigen Sequence DIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Molecular weight 21.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp5-Ser167
Aliases /Synonyms Bacterial non-heme ferritin, 1.16.3.2, ftnA, pfr, jhp_0598
Reference ARO-P11552
Note For research use only.
Molecular Constructor
Asp5–Ser167
Product name ARO-P11552-1MG
Uniprot ID Q9ZLI1
Origin species Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
Expression system Prokaryotic expression
Raw Antigen Sequence DIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Molecular weight 21.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp5-Ser167
Aliases /Synonyms Bacterial non-heme ferritin, 1.16.3.2, ftnA, pfr, jhp_0598
Reference ARO-P11552
Note For research use only.
Molecular Constructor
Asp5–Ser167
Product name ARO-P11552-50
Uniprot ID Q9ZLI1
Origin species Helicobacter pylori (strain J99 / ATCC 700824) (Campylobacter pylori J99)
Expression system Prokaryotic expression
Raw Antigen Sequence DIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIIFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Molecular weight 21.31 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp5-Ser167
Aliases /Synonyms Bacterial non-heme ferritin, 1.16.3.2, ftnA, pfr, jhp_0598
Reference ARO-P11552
Note For research use only.
Molecular Constructor
Asp5–Ser167

SDS-PAGE for Recombinant Helicobacter pylori ftnA/pfr Protein, N-His

SDS-PAGE for Recombinant Helicobacter pylori ftnA/pfr Protein, N-His

Recombinant Helicobacter pylori ftnA/pfr Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant Helicobacter pylori ftnA/pfr Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Helicobacter pylori ftnA/pfr Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products