Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant DENV-1 Envelope protein E, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Uniprot ID:
P17763
Molecular weight:
13.40 kDa

Original price was: €267.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Met577–Lys680
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant DENV-1 Envelope protein E, N-His

Product name ARO-P12712-100
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680
Product name ARO-P12712-1MG
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680
Product name ARO-P12712-50
Uniprot ID P17763
Origin species Dengue virus type 1 (strain Nauru/West Pac/1974) (DENV-1)
Expression system Prokaryotic expression
Raw Antigen Sequence MSYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
Molecular weight 13.40 kDa
Buffer 0.01M PBS, pH 7.4.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met577-Lys680
Aliases /Synonyms Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5, Dengue Virus (DENV)
Reference ARO-P12712
Note For research use only.
Molecular Constructor
Met577–Lys680

Introduction

Recombinant DENV-1 Envelope protein E (rDENV-1 E) is a genetically engineered protein that is derived from the envelope protein of the Dengue virus serotype 1 (DENV-1). This protein is a crucial component of the virus and plays a vital role in its structure, activity and pathogenesis. In recent years, rDENV-1 E has gained significant attention in the scientific community due to its potential as a diagnostic tool and vaccine candidate for Dengue virus.

Structure of rDENV-1 E

The rDENV-1 E protein is composed of 496 amino acids and has a molecular weight of approximately 55 kDa. It is a type I transmembrane protein, with a signal peptide at the N-terminus and a transmembrane domain at the C-terminus. The protein consists of three distinct domains – domain I, II and III. Domain I is the central domain and is responsible for the dimerization of the protein. Domain II is the fusion loop domain, which is involved in the fusion of the virus with host cells. Domain III is the receptor-binding domain, which is responsible for the attachment of the virus to host cells.

Activity of rDENV-1 E

The rDENV-1 E protein is an essential component of the Dengue virus and is involved in multiple stages of the virus life cycle. It plays a crucial role in the attachment and entry of the virus into host cells. The fusion loop domain of rDENV-1 E interacts with host cell receptors, leading to the internalization of the virus. Additionally, rDENV-1 E is also involved in the assembly and release of new viral particles from infected cells.

Apart from its role in the virus life cycle, rDENV-1 E also has immunogenic properties. It can induce a strong immune response in the host, leading to the production of neutralizing antibodies. These antibodies can bind to the virus and prevent its entry into host cells, thereby providing protection against infection.

Application of rDENV-1 E

The unique structural and functional properties of rDENV-1 E make it a promising candidate for various applications in the field of Dengue virus research. One of the major applications of rDENV-1 E is in the development of diagnostic tools for Dengue virus infection. The protein can be used as an antigen in serological tests, such as ELISA, to detect the presence of antibodies against the virus in patient samples. This can aid in the early and accurate diagnosis of Dengue virus infection.

Moreover, rDENV-1 E is also being investigated as a potential vaccine candidate for Dengue virus. The protein has been shown to induce a strong immune response in animal studies, making it a promising candidate for the development of a safe and effective vaccine against Dengue virus. Additionally, rDENV-1 E can also be used in the development of therapeutic antibodies for the treatment of Dengue virus infection.

Conclusion

In conclusion, rDENV-1 E is a genetically engineered protein derived from the envelope protein of the Dengue virus serotype 1. It plays a crucial role in the structure, activity and pathogenesis of the virus. The protein has potential applications in the development of diagnostic tools and vaccines for Dengue virus. Further research and development of rDENV-1 E can lead to significant advancements in the prevention and treatment of Dengue virus infection.

Recombinant DENV-1 Envelope protein E, N-His

There are no reviews yet.

Be the first to review “Recombinant DENV-1 Envelope protein E, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products