Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant CVA6 P2A/Protease 2A Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Coxsackievirus A6 (CVA6)
Uniprot ID:
A0A0H3YLW6
Molecular weight:
18.77 kDa

Original price was: €274.00.Current price is: €228.00.

50ug 17% OFF + 228 loyalty points
His Gly871–Gln1020
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant CVA6 P2A/Protease 2A Protein, N-His

Product name ARO-P15992-100
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020
Product name ARO-P15992-1MG
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020
Product name ARO-P15992-50
Uniprot ID A0A0H3YLW6
Origin species Coxsackievirus A6 (CVA6)
Expression system Prokaryotic expression
Raw Antigen Sequence GKFGQQSGAIYVGNFRVVNRHLATHNDWANLVWESSSRDLLVSSTTAQGCDTIARCDCQTGVYYCNSRRKHYPVSFSKPSLVFVEASEYYPARYQSHLMLAKGHSEPGDCGGILRCQHGVIGIVSTGGGGLVGFADVRDLLWLDEEAMEQ
Molecular weight 18.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly871-Gln1020
Aliases /Synonyms Genome polyprotein, Protease 2A, P2A, 3.4.22.29, Picornain 2A, Protein 2A
Reference ARO-P15992
Note For research use only.
Molecular Constructor
His Gly871–Gln1020

SDS-PAGE for Recombinant CVA6 P2A/Protease 2A Protein, N-His

SDS-PAGE for Recombinant CVA6 P2A/Protease 2A Protein, N-His

Recombinant CVA6 P2A/Protease 2A Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant CVA6 P2A/Protease 2A Protein, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products