Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Cat
Uniprot ID:
P30438
Molecular weight:
36.04 kDa

Original price was: €251.00.Current price is: €228.00.

50ug 9% OFF + 228 loyalty points
GST Glu23–Cys92 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His

Product name ARO-P15704-100
Uniprot ID P30438
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Molecular weight 36.04 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Cys92
Aliases /Synonyms Major allergen I polypeptide chain 1, AG4, Allergen Cat-1, Allergen Fel d I-A, Allergen FdI, Allergen Fel dI, Fel d 1-A, CH1
Reference ARO-P15704
Note For research use only.
Molecular Constructor
GST Glu23–Cys92 His
Product name ARO-P15704-1MG
Uniprot ID P30438
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Molecular weight 36.04 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Cys92
Aliases /Synonyms Major allergen I polypeptide chain 1, AG4, Allergen Cat-1, Allergen Fel d I-A, Allergen FdI, Allergen Fel dI, Fel d 1-A, CH1
Reference ARO-P15704
Note For research use only.
Molecular Constructor
GST Glu23–Cys92 His
Product name ARO-P15704-50
Uniprot ID P30438
Origin species Cat
Expression system Prokaryotic expression
Raw Antigen Sequence EICPAVKRDVDLFLTGTPDEYVEQVAQYKALPVVLENARILKNCVDAKMTEEDKENALSVLDKIYTSPLC
Molecular weight 36.04 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu23-Cys92
Aliases /Synonyms Major allergen I polypeptide chain 1, AG4, Allergen Cat-1, Allergen Fel d I-A, Allergen FdI, Allergen Fel dI, Fel d 1-A, CH1
Reference ARO-P15704
Note For research use only.
Molecular Constructor
GST Glu23–Cys92 His

SDS-PAGE for Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His

SDS-PAGE for Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His

Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Recombinant Cat Fel d 1A/CH1 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products