Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein, C-His-Myc

Host species:
Escherichia coli (E.coli)
Origin species:
Escherichia phage lambda (Bacteriophage lambda)
Uniprot ID:
P03772
Molecular weight:
27.37 kDa

Original price was: €269.00.Current price is: €230.00.

50ug 14% OFF + 230 loyalty points
Met1–Ala221
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein, C-His-Myc

Product name ARO-P10946-100
Uniprot ID P03772
Origin species Escherichia phage lambda (Bacteriophage lambda)
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Serine/threonine-protein phosphatase, 3.1.3.16
Reference ARO-P10946
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P10946-1MG
Uniprot ID P03772
Origin species Escherichia phage lambda (Bacteriophage lambda)
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Serine/threonine-protein phosphatase, 3.1.3.16
Reference ARO-P10946
Note For research use only.
Molecular Constructor
Met1–Ala221
Product name ARO-P10946-50
Uniprot ID P03772
Origin species Escherichia phage lambda (Bacteriophage lambda)
Expression system Prokaryotic expression
Raw Antigen Sequence MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Molecular weight 27.37 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala221
Aliases /Synonyms Serine/threonine-protein phosphatase, 3.1.3.16
Reference ARO-P10946
Note For research use only.
Molecular Constructor
Met1–Ala221

Introduction

The Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein, also known as Lambda Ser/Thr-PPase, is a protein that plays a crucial role in regulating cellular signaling pathways. It is a recombinant protein that is derived from the bacteriophage Lambda, a virus that infects bacteria. This protein has been extensively studied and its structure, activity, and applications have been well characterized. In this article, we will provide a comprehensive description of this protein, highlighting its importance and potential uses in various fields.

Structure of Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein

The Lambda Ser/Thr-PPase protein is a member of the protein phosphatase family, which is responsible for removing phosphate groups from other proteins. It is a homodimeric protein, meaning it is composed of two identical subunits. Each subunit contains a catalytic domain and a regulatory domain. The catalytic domain is responsible for the enzymatic activity of the protein, while the regulatory domain helps in its proper functioning and regulation.

The overall structure of the Lambda Ser/Thr-PPase protein is similar to other protein phosphatases, with a central core formed by the catalytic domain and a more flexible regulatory domain. The catalytic domain contains a conserved active site, which is responsible for the dephosphorylation of its target proteins. The regulatory domain, on the other hand, contains binding sites for various regulatory molecules, which can modulate the activity of the protein.

Activity of Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein

The main function of the Lambda Ser/Thr-PPase protein is to regulate the activity of other proteins by removing phosphate groups from them. This dephosphorylation process is crucial in many cellular signaling pathways, as it can either activate or inhibit the function of target proteins. The Lambda Ser/Thr-PPase protein has been shown to dephosphorylate a wide range of target proteins, including transcription factors, kinases, and other signaling molecules.

Moreover, the activity of the Lambda Ser/Thr-PPase protein can also be regulated by other molecules. For example, binding of regulatory proteins to the regulatory domain can either enhance or inhibit the enzymatic activity of the protein. This allows for fine-tuning of its activity and precise regulation of cellular signaling pathways.

Applications of Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein

The Lambda Ser/Thr-PPase protein has a wide range of potential applications in various fields, including biotechnology, medicine, and research. One of its main applications is in the production of recombinant proteins. The Lambda Ser/Thr-PPase protein can be used to remove phosphate groups from recombinant proteins, which can improve their stability and activity. This is particularly useful in the production of therapeutic proteins, where stability and activity are crucial for their effectiveness.

In addition, the Lambda Ser/Thr-PPase protein has been studied for its potential role in cancer treatment. It has been shown to dephosphorylate proteins involved in cancer cell growth and survival, making it a potential target for anti-cancer therapies. Furthermore, the protein has also been studied for its role in neurodegenerative diseases, as it has been shown to regulate the activity of proteins involved in these conditions.

Lastly, the Lambda Ser/Thr-PPase protein has been used as a research tool to study various cellular signaling pathways and their regulation. Its ability to dephosphorylate a wide range of target proteins makes it a valuable tool for understanding the complex mechanisms of cellular signaling.

Conclusion

In conclusion, the Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein is a crucial protein involved in regulating cellular signaling pathways

Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein, C-His-Myc

There are no reviews yet.

Be the first to review “Recombinant Bacteriophage Lambda Serine/threonine-protein phosphatase Protein, C-His-Myc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products