Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Uniprot ID:
P67875
Molecular weight:
19.15 kDa

Original price was: €230.00.Current price is: €193.00.

50ug 16% OFF + 193 loyalty points
Ala28–His176
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

Product name ARO-P11499-100
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176
Product name ARO-P11499-1MG
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176
Product name ARO-P11499-50
Uniprot ID P67875
Origin species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Expression system Prokaryotic expression
Raw Antigen Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Molecular weight 19.15 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-His176
Aliases /Synonyms Ribonuclease mitogillin, 3.1.27.-, Allergen Asp f I, Allergen I/a, IgE-binding ribotoxin, Major allergen Asp f 1, Asp f 1, mitF, aspF1, AFUA_5G02330
Reference ARO-P11499
Note For research use only.
Molecular Constructor
Ala28–His176

Introduction

Recombinant Aspergillus fumigatus Asp f 1/mitF protein is a genetically engineered protein that has been derived from the Aspergillus fumigatus fungus. This protein is also known as mitF protein and is an important antigen in the diagnosis and treatment of Aspergillus fumigatus infections. In this article, we will discuss the structure, activity, and applications of recombinant Asp f 1/mitF protein.

Structure of Recombinant Asp f 1/mitF Protein

Recombinant Asp f 1/mitF protein is a 38 kDa protein that is composed of 343 amino acids. It is a glycoprotein, meaning it contains carbohydrate chains attached to it. The protein has a three-dimensional structure that is crucial for its function as an antigen. It is composed of two domains, an N-terminal domain and a C-terminal domain. The N-terminal domain is responsible for the binding of Asp f 1/mitF protein to specific receptors on the surface of immune cells. The C-terminal domain contains the active site of the protein, which is responsible for its enzymatic activity.

Activity of Recombinant Asp f 1/mitF Protein

Recombinant Asp f 1/mitF protein is a major allergen in Aspergillus fumigatus infections. It is responsible for the development of allergic reactions in individuals who are sensitized to this fungus. The protein is able to stimulate the production of specific antibodies and immune cells, which leads to an inflammatory response in the body. This can manifest as symptoms such as asthma, allergic rhinitis, and hypersensitivity pneumonitis.

Apart from its role as an allergen, recombinant Asp f 1/mitF protein also has enzymatic activity. It is a metalloprotease, meaning it is able to break down proteins by cleaving peptide bonds. This activity is important for the fungus to invade and colonize host tissues, as well as for the development of allergic reactions.

Application of Recombinant Asp f 1/mitF Protein

Recombinant Asp f 1/mitF protein has several applications in the diagnosis and treatment of Aspergillus fumigatus infections. It is a major component of diagnostic tests, such as skin prick tests and IgE antibody tests, which are used to identify individuals who are sensitized to this fungus. These tests are important for the early detection and management of Aspergillus fumigatus infections, which can be life-threatening in immunocompromised individuals.

In addition, recombinant Asp f 1/mitF protein is being studied as a potential vaccine candidate for the prevention of Aspergillus fumigatus infections. By inducing an immune response against the protein, it may be possible to prevent or reduce the severity of allergic reactions and fungal infections caused by this fungus.

Moreover, recombinant Asp f 1/mitF protein is also being investigated as a potential therapeutic target for the treatment of Aspergillus fumigatus infections. Inhibitors of this protein could potentially be used to block its enzymatic activity and prevent the fungus from invading host tissues. This could be a promising approach for the development of new antifungal drugs.

Conclusion

Recombinant Aspergillus fumigatus Asp f 1/mitF protein is an important antigen in the diagnosis and treatment of Aspergillus fumigatus infections. Its structure, activity, and applications make it a valuable tool in the management of this fungus. Further research on this protein may lead to new and improved diagnostic and therapeutic options for Aspergillus fumigatus infections.

Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Aspergillus fumigatus Asp f 1/mitF Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products