Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant ASFV I177L Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
African swine fever virus
Uniprot ID:
YP_009927266
Molecular weight:
20.16 kDa

Original price was: €424.00.Current price is: €329.00.

100ug 22% OFF + 329 loyalty points
Lys22–Phe177
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant ASFV I177L Protein, N-His

Product name ARO-P12756-100
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177
Product name ARO-P12756-1MG
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177
Product name ARO-P12756-50
Uniprot ID YP_009927266
Origin species African swine fever virus
Expression system Prokaryotic expression
Raw Antigen Sequence KTPFKCITTTKTPVLFIKFQLIAADNYQAITWKDGILNYEKIDQPTPLYLSVNGLIFDCAKLQPLTTKSNVTSGDKVVHIGQTFEYNNLLMWKVNDQGFLNISVTGTKFNLIAITGKLGFYTDPPSHLIIMPLKFFPVHKFSKNEPNKKQKRFIYF
Molecular weight 20.16 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Lys22-Phe177
Aliases /Synonyms hypothetical protein IM014_gp175, I177L CDS, African Swine Fever Virus (ASFV)
Reference ARO-P12756
Note For research use only.
Molecular Constructor
Lys22–Phe177

Introduction

The recombinant ASFV I177L protein is a viral protein that has been genetically engineered for use in various research and diagnostic applications. It is a highly specific and sensitive antigen that has been shown to have potential in the development of new vaccines and diagnostic tools for African swine fever virus (ASFV).

Structure of Recombinant ASFV I177L Protein

The recombinant ASFV I177L protein is a 177 amino acid protein that is derived from the I177L gene of the ASFV genome. It is a structural protein that is found on the surface of the virus and is responsible for viral attachment and entry into host cells. The recombinant protein is produced using molecular cloning techniques, where the I177L gene is inserted into a suitable expression vector and then expressed in a host cell such as E. coli or insect cells.

The recombinant protein is then purified and can be used in a variety of applications due to its high purity and specificity. It is important to note that the recombinant ASFV I177L protein is not infectious and does not pose a risk to human or animal health.

Activity of Recombinant ASFV I177L Protein

The recombinant ASFV I177L protein is a highly active protein that has been shown to have a strong binding affinity for ASFV. It is able to specifically recognize and bind to the virus, making it a valuable tool in the development of diagnostic tests. The protein is also able to induce a strong immune response in animals, making it a potential candidate for use in vaccine development.

Additionally, the recombinant protein has been shown to have potential in the development of novel antiviral therapies. It has been found to interfere with viral entry and replication, making it a promising target for the development of drugs to combat ASFV infections.

Application of Recombinant ASFV I177L Protein

The recombinant ASFV I177L protein has a wide range of applications in both research and diagnostic settings. Some of the key applications include:

Vaccine Development

The recombinant protein has been identified as a potential candidate for use in the development of a vaccine against ASFV. Its ability to induce a strong immune response and its specificity for the virus make it a promising component of a multi-component vaccine.

Diagnostic Tests

The recombinant protein can be used in various diagnostic tests for the detection of ASFV. These include enzyme-linked immunosorbent assays (ELISAs), lateral flow assays, and immunofluorescence assays. Its high specificity and sensitivity make it a valuable tool for the accurate and early detection of ASFV infections.

Antiviral Therapy

The recombinant ASFV I177L protein has potential as a target for the development of antiviral drugs. Its ability to interfere with viral entry and replication makes it a promising candidate for the development of novel therapeutics to combat ASFV infections.

Research Tool

The recombinant protein can also be used as a research tool to study the structure and function of ASFV. Its high purity and specificity make it a valuable tool for studying the virus and its interactions with host cells.

Conclusion

The recombinant ASFV I177L protein is a highly specific and sensitive antigen that has a wide range of applications in the field of ASFV research and diagnostics. Its potential as a vaccine candidate and target for antiviral therapy make it a valuable tool in the fight against this devastating virus. With ongoing research and development, the recombinant protein has the potential to contribute significantly to the control and prevention of ASFV outbreaks.

SDS-PAGE for Recombinant ASFV I177L Protein, N-His

SDS-PAGE for Recombinant ASFV I177L Protein, N-His

Recombinant ASFV I177L Protein, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Recombinant ASFV I177L Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant ASFV I177L Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products