Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc

Host species:
Mammalian cells
Origin species:
African swine fever virus
Uniprot ID:
Q65200
Molecular weight:
50.18 kDa

Original price was: €326.00.Current price is: €294.00.

50ug 10% OFF + 294 loyalty points
Gly2–Asn199 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc

Product name ARO-P15977-100
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc
Product name ARO-P15977-1MG
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc
Product name ARO-P15977-50
Uniprot ID Q65200
Origin species African swine fever virus
Expression system Eukaryotic expression
Raw Antigen Sequence GGSTSKNSFKNTTNIISNSIFNQMQNCISMLDGKNYIGVFGDGNILNHVFQDLNLSLDTSCVQKHVNEENFITNLSNQITQNLKDQEVALTQWMDAGHHDQKTDIEENIKVNLTTTLIQNCVSSLSGMNVLVVKGNGNIVENATQKQSQQIISNCLQGSKQAIDTTTGITNTVNQYSHYTSKNFFDFIADAISAVFKN
Molecular weight 50.18 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Gly2-Asn199
Aliases /Synonyms Inner membrane protein pE248R, pE248R, Ba71V-132, E248R
Reference ARO-P15977
Note For research use only.
Molecular Constructor
Gly2–Asn199 Fc

There are no reviews yet.

Be the first to review “Recombinant ASFV E248R/Ba71V-132 Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products