Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Almond Pru1 Pru du 6.0101 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Almond
Uniprot ID:
E3SH28
Molecular weight:
21.68 kDa

Original price was: €287.00.Current price is: €228.00.

50ug 21% OFF + 228 loyalty points
His Asn381–Val551
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Almond Pru1 Pru du 6.0101 Protein, N-His

Product name ARO-P15701-100
Uniprot ID E3SH28
Origin species Almond
Expression system Prokaryotic expression
Raw Antigen Sequence NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV
Molecular weight 21.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn381-Val551
Aliases /Synonyms Prunin 1 Pru du 6.0101, Pru1 Pru du 6.0101, 11S globulin, 11S seed storage protein, Allergen Pru du 6.01, Amandin Pru du 6.0101, Pru du 6.0101, Prunin 1 Pru du 6.0101 acidic chain, Prunin 1 Pru du 6.0101 basic chain
Reference ARO-P15701
Note For research use only.
Molecular Constructor
His Asn381–Val551
Product name ARO-P15701-1MG
Uniprot ID E3SH28
Origin species Almond
Expression system Prokaryotic expression
Raw Antigen Sequence NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV
Molecular weight 21.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn381-Val551
Aliases /Synonyms Prunin 1 Pru du 6.0101, Pru1 Pru du 6.0101, 11S globulin, 11S seed storage protein, Allergen Pru du 6.01, Amandin Pru du 6.0101, Pru du 6.0101, Prunin 1 Pru du 6.0101 acidic chain, Prunin 1 Pru du 6.0101 basic chain
Reference ARO-P15701
Note For research use only.
Molecular Constructor
His Asn381–Val551
Product name ARO-P15701-50
Uniprot ID E3SH28
Origin species Almond
Expression system Prokaryotic expression
Raw Antigen Sequence NIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYRNGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGNQGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSSSQQRRAVV
Molecular weight 21.68 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn381-Val551
Aliases /Synonyms Prunin 1 Pru du 6.0101, Pru1 Pru du 6.0101, 11S globulin, 11S seed storage protein, Allergen Pru du 6.01, Amandin Pru du 6.0101, Pru du 6.0101, Prunin 1 Pru du 6.0101 acidic chain, Prunin 1 Pru du 6.0101 basic chain
Reference ARO-P15701
Note For research use only.
Molecular Constructor
His Asn381–Val551

There are no reviews yet.

Be the first to review “Recombinant Almond Pru1 Pru du 6.0101 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products