Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Rat Resistin-like alpha(Retnla)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Rat Resistin-like alpha(Retnla) |
|---|---|
| Uniprot ID | Q99P85 |
| Uniprot link | https://www.uniprot.org/uniprot/Q99P85 |
| Origin species | Rattus norvegicus (Rat) |
| Expression system | Eukaryotic expression |
| Sequence | MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLS |
| Molecular weight | 35-40kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | Tris-glycine |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Ser111 |
| Protein Accession | Q99P85 |
| Spec:Entrez GeneID | 81712 |
| Spec:NCBI Gene Aliases | Himf |
| NCBI Reference | Q99P85 |
| Aliases /Synonyms | Fizz1,Cysteine-rich secreted protein FIZZ1,RELMalpha |
| Reference | PX-P4554 |
| Note | For research use only |
Related products
Tag Antibody
Anti human IgG Fc tag mouse monoclonal antibody
PTX17868 180€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.