Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rat AADAT Recombinant Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Rat
Uniprot ID:
Q64602
Molecular weight:
45.74 kDa

Original price was: €296.00.Current price is: €228.00.

50ug 23% OFF + 228 loyalty points
GST Val271–Ser425 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Rat AADAT Recombinant Protein, N-GST & C-His

Product name ARO-P19022-100
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His
Product name ARO-P19022-1MG
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His
Product name ARO-P19022-50
Uniprot ID Q64602
Origin species Rat
Expression system Prokaryotic expression
Raw Antigen Sequence VGFITGPKSLIQRIVLHTQISSLHPCTLSQLMISELLYQWGEEGFLAHVDRAIDFYKNQRDFILAAADKWLRGLAEWHVPKAGMFLWIKVNGISDAKKLIEEKAIEREILLVPGNSFFVDNSAPSSFFRASFSQVTPAQMDLVFQRLAQLIKDVS
Molecular weight 45.74 kDa
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val271-Ser425
Aliases /Synonyms 2-aminoadipate aminotransferase, 2-aminoadipate transaminase, AADAT, AadAT, Alpha-aminoadipate aminotransferase, EC:2.6.1.39, EC:2.6.1.4, EC:2.6.1.63, EC:2.6.1.7, EC:2.6.1.73, Glycine transaminase AADAT, KAT/AadAT, KAT2, KYAT2, Kynurenine aminotransferase II, Kynurenine--glyoxylate transaminase AADAT, Kynurenine--oxoglutarate aminotransferase II, Kynurenine--oxoglutarate transaminase 2, Kynurenine--oxoglutarate transaminase II, Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial, Methionine--glyoxylate transaminase AADAT
Reference ARO-P19022
Note For research use only.
Molecular Constructor
GST Val271–Ser425 His

There are no reviews yet.

Be the first to review “Rat AADAT Recombinant Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products