Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Rabies virus Nucleoprotein Recombinant Protein |
|---|---|
| Uniprot ID | Q0PNB8 |
| Uniprot link | http://www.uniprot.org/uniprot/Q0PNB8 |
| Origin species | Rabies virus |
| Expression system | Prokaryotic expression |
| Sequence | MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH |
| Molecular weight | 51.58 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | Tris-HC 50mMl, NaCl 150mM, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| NCBI Reference | Q0PNB8 |
| Aliases /Synonyms | Nucleoprotein |
| Reference | PX-P3020 |
| Note | For research use only. |
Rabies rabies virus (a species of the Rhabdoviridae family), formerly a rabies virus, is a neurological virus that causes rabies in humans and animals. Rabies virus is an RNA virus wrapped in green or unidirectional, negative, non-secreting. Genomic anger codes for five proteins: nuclear protein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two important structural components: the spiral core of ribonucleoprotein (RNP) and the lipoprotein envelope surrounded by the spiny thorns of glycoprotein (G).
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.