Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Insect |
Applications | Elisa, WB |
Product name | Rabies virus Nucleoprotein Recombinant Protein |
---|---|
Uniprot ID | Q0PNB8 |
Uniprot link | http://www.uniprot.org/uniprot/Q0PNB8 |
Origin species | Rabies virus |
Expression system | Prokaryotic expression |
Sequence | MDADKIVFRVNNQVVSLKPEIIVDQYEYKYPAIKDLKKPSITLGKAPDLNKAYKSVLSGMNAAKLDPDDVCSYLAAAMQFFEGTCPEDWNSYGILIARKGDKITPDSLVDIKRTDVEGNWALTGGMELTRDPTVSEHASLVGLLLSLYRLSKISGQNTGNYKTNIADRIEQIFETAPFVKIVEHHTLMTTHKMCANWSTIPNFRFLAGTYDMFFSRIEHLYSAIRVGTVVTAYEDCSGLVSFTGFIKQINLTAKEAILYFFHKNFEEEIRRMFEPGQETAVPHSYFIHFRSLGLSGKSPYSSNAVGHVFNLIHFVGCYMGQVRSLNATVIAACAPHEMSVLGGYLGEEFFGKGTFERRFFRDEKELQEYEAAELTKTDLALADDGTVNSDDEDYFSGETRSPEAVYTRIMMNGGRLKRSHIRRYVSVSSNHQARPNSFAEFLNKTYSSDSGSHHHHHH |
Molecular weight | 51.58 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 85% |
Buffer | Tris-HC 50mMl, NaCl 150mM, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
NCBI Reference | Q0PNB8 |
Aliases /Synonyms | Nucleoprotein |
Reference | PX-P3020 |
Note | For research use only. |
Rabies rabies virus (a species of the Rhabdoviridae family), formerly a rabies virus, is a neurological virus that causes rabies in humans and animals. Rabies virus is an RNA virus wrapped in green or unidirectional, negative, non-secreting. Genomic anger codes for five proteins: nuclear protein (N), phosphoprotein (P), matrix protein (M), glycoprotein (G) and polymerase (L). It has two important structural components: the spiral core of ribonucleoprotein (RNP) and the lipoprotein envelope surrounded by the spiny thorns of glycoprotein (G).
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.