Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Plasmodium MSP1-p19 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Plasmodium
Uniprot ID:
X2J7U7
Molecular weight:
23.79 kDa

493.00

100ug + 493 loyalty points
Partial
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Plasmodium MSP1-p19 Recombinant Protein

Product name Plasmodium MSP1-p19 Recombinant Protein
Uniprot ID X2J7U7
Uniprot link http://www.uniprot.org/uniprot/X2J7U7
Origin species Plasmodium
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGMEVKIQKIKDNNNVQETIENLKKNKREGEDNYLYDSNNRTKKLSPNEHRNRKQLWTRFKQLRIVHENNMNSLFSNFDQQDLEQIYEDVSQHICINTVCPINSGCIRRLNGKEECRCLLNFKKEGMMCVPDENPTCEINNGGCDTTANCTSNGEQITCTCKLNKSFPIHQGIFCSSSNYLSLSFLLIIIFIYIT
Molecular weight 23.79 kDa
Purity estimated 80%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AHN52397.1
Spec:SwissProtID X2J7U7
NCBI Reference AHN52397.1
Aliases /Synonyms MSP1-p19, Merozoite surface protein 2
Reference PX-P2080
Note For research use only
Molecular Constructor
Partial
Product name Plasmodium MSP1-p19 Recombinant Protein
Uniprot ID X2J7U7
Uniprot link http://www.uniprot.org/uniprot/X2J7U7
Origin species Plasmodium
Expression system Prokaryotic expression
Sequence MGSSHHHHHHSSGMEVKIQKIKDNNNVQETIENLKKNKREGEDNYLYDSNNRTKKLSPNEHRNRKQLWTRFKQLRIVHENNMNSLFSNFDQQDLEQIYEDVSQHICINTVCPINSGCIRRLNGKEECRCLLNFKKEGMMCVPDENPTCEINNGGCDTTANCTSNGEQITCTCKLNKSFPIHQGIFCSSSNYLSLSFLLIIIFIYIT
Molecular weight 23.79 kDa
Purity estimated 80%
Buffer PBS, pH 7.5
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AHN52397.1
Spec:SwissProtID X2J7U7
NCBI Reference AHN52397.1
Aliases /Synonyms MSP1-p19, Merozoite surface protein 1
Reference PX-P2080
Note For research use only
Molecular Constructor
Partial

General information on Plasmodium MSP1-p19 Recombinant Protein

MSP1-p19 (Merozoite surface proteins) is a protein located on the surface of Plasmodium falciparum merozoites. The protein is a good target for vaccine development against malaria, a disease caused by protozoans because they are accessible to antibodies in the plasma. It also induce both inhibitory as well as blocking antibodies, the latter blocking the protective effects of the former. The malaria parasite, in its asexual, blood invading stage called the merozoite stage, infects red blood cells. The MSP1 complex of surface proteins likely mediates the first interactions of the parasite with red blood cells.

  • Hellgren O, Kutzer M, Bensch S, Valkiūnas G, Palinauskas V. Identification and characterization of the merozoite surface protein 1 (msp1) gene in a host-generalist avian malaria parasite, Plasmodium relictum (lineages SGS1 and GRW4) with the use of blood transcriptome. Malar J. 2013 Oct 30;12:381. doi: 10.1186/1475-2875-12-381. PubMed PMID: 24172200; PubMed Central PMCID: PMC3827925.

There are no reviews yet.

Be the first to review “Plasmodium MSP1-p19 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products