Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Plasmodium falciparum RESA-2 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Plasmodium falciparum
Uniprot ID:
Q8IHM8
Molecular weight:
47,06 kDa

€1,134.00

100ug + 1134 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Plasmodium falciparum RESA-2 Recombinant Protein

Plasmodium falciparum RESA-2 Recombinant Protein

Product name Plasmodium falciparum RESA-2 Recombinant Protein
Uniprot ID Q8IHM8
Uniprot link http://www.uniprot.org/uniprot/Q8IHM8
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLPILDSMAH IFINVSQCYIGNQEKAKKKIQNRFKKNKLKSSCAYNELRYTLREYFKTRKQVSSLSYTLENNNNKKYNQNKWYKNITNLD DKNKYKILYSFVKNLIKIALSDIEYTIKTVCENILTEKGIDDITIKARAESLNKLGYIIRQNILKGKNIKKIIKCDSRNI AANI
Molecular weight 47,06 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer TrisHC 50mMl, 2% SDS, pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XM_001348132.1
Spec:Entrez GeneID 811044
Spec:SwissProtID Q8IHM8
NCBI Reference XM_001348132.1
Aliases /Synonyms RESA-2, RESA-like protein with PHIST and DnaJ domains
Reference PX-P1146
Note For research use only
Molecular Constructor
Partial Yes
Product name Plasmodium falciparum RESA-2 Recombinant Protein
Uniprot ID Q8IHM8
Uniprot link http://www.uniprot.org/uniprot/Q8IHM8
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLPILDSMAH IFINVSQCYIGNQEKAKKKIQNRFKKNKLKSSCAYNELRYTLREYFKTRKQVSSLSYTLENNNNKKYNQNKWYKNITNLD DKNKYKILYSFVKNLIKIALSDIEYTIKTVCENILTEKGIDDITIKARAESLNKLGYIIRQNILKGKNIKKIIKCDSRNI AANI
Molecular weight 47,06 kDa
Protein delivered with Tag? Yes
Purity estimated 60%
Buffer TrisHC 50mMl, 2% SDS, pH8
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession XM_001348132.1
Spec:Entrez GeneID 811044
Spec:SwissProtID Q8IHM8
NCBI Reference XM_001348132.1
Aliases /Synonyms RESA-2, RESA-like protein with PHIST and DnaJ domains
Reference PX-P1146
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Plasmodium falciparum RESA-2 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products