Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Plasmodium falciparum PFL1260 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Plasmodium falciparum
Uniprot ID:
Q8I5F6
Molecular weight:
37,55 kDa

Original price was: €303.00.Current price is: €259.00.

50ug 15% OFF + 259 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Plasmodium falciparum PFL1260 Recombinant Protein

Product name Plasmodium falciparum PFL1260 Recombinant Protein
Uniprot ID Q8I5F6
Uniprot link http://www.uniprot.org/uniprot/Q8I5F6
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Raw Antigen Sequence MLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMKMFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYIYTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNKIVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYRVLSGRRS
Molecular weight 37,55 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_001350658.1
Spec:Entrez GeneID 811304
Spec:SwissProtID Q8I5F6
NCBI Reference XP_001350658.1
Aliases /Synonyms PFL1260, hydrolase / phosphatase, putative
Reference PX-P1140
Note For research use only
Molecular Constructor
Full-length Yes
Product name Plasmodium falciparum PFL1260 Recombinant Protein
Uniprot ID Q8I5F6
Uniprot link http://www.uniprot.org/uniprot/Q8I5F6
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Raw Antigen Sequence MLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMKMFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYIYTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNKIVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYRVLSGRRS
Molecular weight 37,55 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_001350658.1
Spec:Entrez GeneID 811304
Spec:SwissProtID Q8I5F6
NCBI Reference XP_001350658.1
Aliases /Synonyms PFL1260, hydrolase / phosphatase, putative
Reference PX-P1140
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1140-1MG
Uniprot ID Q8I5F6
Uniprot link http://www.uniprot.org/uniprot/Q8I5F6
Origin species Plasmodium falciparum
Expression system Prokaryotic expression
Raw Antigen Sequence MLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMKMFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYIYTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNKIVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYRVLSGRRS
Molecular weight 37,55 kDa
Protein delivered with Tag? Yes
Purity estimated 70%
Buffer 100mM Na2HPO4, TrisHCl 10mM, Urea 8M
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession XP_001350658.1
Spec:Entrez GeneID 811304
Spec:SwissProtID Q8I5F6
NCBI Reference XP_001350658.1
Aliases /Synonyms PFL1260, hydrolase / phosphatase, putative
Reference PX-P1140
Note For research use only
Molecular Constructor
Full-length Yes

Plasmodium falciparum PFL1260 Recombinant Protein

There are no reviews yet.

Be the first to review “Plasmodium falciparum PFL1260 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products