Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Plasmodium falciparum PFL1260 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Plasmodium falciparum PFL1260 Recombinant Protein |
|---|---|
| Uniprot ID | Q8I5F6 |
| Uniprot link | http://www.uniprot.org/uniprot/Q8I5F6 |
| Origin species | Plasmodium falciparum |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLMLKHKYNDSCVQELFYKNNIKLIAIDIDGTLADDTGKISDENLKAIEVCKKGGIEIILASGRLHSYAMK MFTNEQIEKYKIEKLDGVYSHGAYIHMKGYDYVYRKFSYKDLELILFSLGSYNILRNAVFLTVDSAYVINDDIKLIEEYI YTPESEGIISDIEYVKIIDTNYKPILINKIKDIFNIGDIVSIEIYDKLYPNQDIYSDLFKVLFYELQPHYKIYIPSSNNK IVLSPINTAKVHTTQLYAQFYRINLNNILSIGNDDNDIELLSSTGFSVAVKNSTPRALQVARCVSTKTNNENAVANIIYR VLSGRRS |
| Molecular weight | 37,55 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | 100mM Na2HPO4, TrisHCl 10mM, Urea 8M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Full-length |
| Protein Accession | XP_001350658.1 |
| Spec:Entrez GeneID | 811304 |
| Spec:SwissProtID | Q8I5F6 |
| NCBI Reference | XP_001350658.1 |
| Aliases /Synonyms | PFL1260, hydrolase / phosphatase, putative |
| Reference | PX-P1140 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.