Name: Peptidoglycan hydrolase
SKU: PX-P4658-10
Availability: InStock

Product name	Peptidoglycan hydrolase
Uniprot ID	A0A411CWC0
Origin species	Thermus phage TSP4
Expression system	Prokaryotic expression
Sequence	MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Bacillus subtilis
Applications	ELISA,WB
Fragment Type	Met1-Lys166
Reference	PX-P4658
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Peptidoglycan hydrolase”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.