Name: Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein
SKU: PX-P1133-10
Availability: InStock

Product name	Ostreid herpesvirus Putative apoptosis inhibitor ORF87 Recombinant Protein
Uniprot ID	Q6R7E2
Uniprot link	http://www.uniprot.org/uniprot/Q6R7E2
Origin species	Ostreid herpesvirus
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLMDIVPISPYERMRPLRESKELRIKSFDDHRWPHKNNPVMTKNMIENYFYYIGINDKIQCVHCGGVISGF LEEDTHRISYEHRRHFPKCPVGKYRHPGYHLDAERLKSFKNWRYENIVRKMDLVAAGLFYTGIEDRCACHQCGNELYEWE AGDNPKEEHKRLFPDCKLSSY
Molecular weight	21,69 kDa
Protein delivered with Tag?	Yes
Purity estimated	85%
Buffer	PBS, Urea 6M
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Full-length
Protein Accession	YP_024626.1
Spec:Entrez GeneID	2948187
Spec:SwissProtID	Q6R7E2
NCBI Reference	YP_024626.1
Aliases /Synonyms	ORF87, ORF87
Reference	PX-P1133
Note	For research use only

No Products found