Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Orthohantavirus puumalaense Glycoprotein C/Gc, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Puumala virus
Uniprot ID:
AJC50718.1

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points
His Glu659–Glu1105
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Orthohantavirus puumalaense Glycoprotein C/Gc, N-His

Product name ARO-P18448-100
Uniprot ID AJC50718.1
Origin species Puumala virus
Expression system Prokaryotic expression
Raw Antigen Sequence ETQNLNSGWTDTAHGSGVIPMRTDLELDFSLPSSASYTYRRQLQNPANEQEKIPFHLQISKQVIHAEIQHLGHWMDGTFNLKTAFHCYGSCEKYAYPWQTAGCFVEKDYEYESGWGCNPADCPGVGTGCTACGVYLDKLKSVGKAFKIVSLRYTRKACIQLGTEQTCKNVDSNDCLVTTSVKVCLIGTVSKFQPSDTLLFLGPLEQGGLIFKQWCTTTCQFGDPGDIMSTPVGMKCPELSGSFRKKCAFATTPVCQFDGNTISGYKRMIATKDSFQSFNVTEPHISASSLEWIDPDSSLRDHINVIVGRDLSFQDLSETPCQVDLTTTSIDGAWGSGVGFNLICSVSLTECSTFLTSIKACDSAMCYGSTTANLVRGQNTVHIVGKGGHSGSKFMCCHDTKCSSTGLVAAAPHLDRVTGYNQADSDKIFDDGAPECGISCWFTKSGE
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu659-Glu1105
Aliases /Synonyms Envelopment polyprotein, M polyprotein, Glycoprotein N, Glycoprotein C, Gc, Glycoprotein G2, GP
Reference ARO-P18448
Note For research use only.
Molecular Constructor
His Glu659–Glu1105
Product name ARO-P18448-1MG
Uniprot ID AJC50718.1
Origin species Puumala virus
Expression system Prokaryotic expression
Raw Antigen Sequence ETQNLNSGWTDTAHGSGVIPMRTDLELDFSLPSSASYTYRRQLQNPANEQEKIPFHLQISKQVIHAEIQHLGHWMDGTFNLKTAFHCYGSCEKYAYPWQTAGCFVEKDYEYESGWGCNPADCPGVGTGCTACGVYLDKLKSVGKAFKIVSLRYTRKACIQLGTEQTCKNVDSNDCLVTTSVKVCLIGTVSKFQPSDTLLFLGPLEQGGLIFKQWCTTTCQFGDPGDIMSTPVGMKCPELSGSFRKKCAFATTPVCQFDGNTISGYKRMIATKDSFQSFNVTEPHISASSLEWIDPDSSLRDHINVIVGRDLSFQDLSETPCQVDLTTTSIDGAWGSGVGFNLICSVSLTECSTFLTSIKACDSAMCYGSTTANLVRGQNTVHIVGKGGHSGSKFMCCHDTKCSSTGLVAAAPHLDRVTGYNQADSDKIFDDGAPECGISCWFTKSGE
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu659-Glu1105
Aliases /Synonyms Envelopment polyprotein, M polyprotein, Glycoprotein N, Glycoprotein C, Gc, Glycoprotein G2, GP
Reference ARO-P18448
Note For research use only.
Molecular Constructor
His Glu659–Glu1105
Product name ARO-P18448-50
Uniprot ID AJC50718.1
Origin species Puumala virus
Expression system Prokaryotic expression
Raw Antigen Sequence ETQNLNSGWTDTAHGSGVIPMRTDLELDFSLPSSASYTYRRQLQNPANEQEKIPFHLQISKQVIHAEIQHLGHWMDGTFNLKTAFHCYGSCEKYAYPWQTAGCFVEKDYEYESGWGCNPADCPGVGTGCTACGVYLDKLKSVGKAFKIVSLRYTRKACIQLGTEQTCKNVDSNDCLVTTSVKVCLIGTVSKFQPSDTLLFLGPLEQGGLIFKQWCTTTCQFGDPGDIMSTPVGMKCPELSGSFRKKCAFATTPVCQFDGNTISGYKRMIATKDSFQSFNVTEPHISASSLEWIDPDSSLRDHINVIVGRDLSFQDLSETPCQVDLTTTSIDGAWGSGVGFNLICSVSLTECSTFLTSIKACDSAMCYGSTTANLVRGQNTVHIVGKGGHSGSKFMCCHDTKCSSTGLVAAAPHLDRVTGYNQADSDKIFDDGAPECGISCWFTKSGE
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu659-Glu1105
Aliases /Synonyms Envelopment polyprotein, M polyprotein, Glycoprotein N, Glycoprotein C, Gc, Glycoprotein G2, GP
Reference ARO-P18448
Note For research use only.
Molecular Constructor
His Glu659–Glu1105

There are no reviews yet.

Be the first to review “Orthohantavirus puumalaense Glycoprotein C/Gc, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products