Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Oropouche virus/OROV Glycoprotein G2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Oropouche virus
Uniprot ID:
NP_982303.1

Original price was: €258.00.Current price is: €228.00.

50ug 12% OFF + 228 loyalty points
His His17–Asn208
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Oropouche virus/OROV Glycoprotein G2, N-His

Oropouche virus/OROV Glycoprotein G2, N-His

Product name ARO-P18055-100
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Prokaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18055
Note For research use only.
Molecular Constructor
His His17–Asn208
Product name ARO-P18055-1MG
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Prokaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18055
Note For research use only.
Molecular Constructor
His His17–Asn208
Product name ARO-P18055-50
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Prokaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18055
Note For research use only.
Molecular Constructor
His His17–Asn208

SDS-PAGE for Oropouche virus/OROV Glycoprotein G2, N-His

SDS-PAGE for Oropouche virus/OROV Glycoprotein G2, N-His

Oropouche virus/OROV Glycoprotein G2, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Oropouche virus/OROV Glycoprotein G2, N-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products