Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oropouche virus/OROV Glycoprotein G2, C-His

Host species:
Mammalian cells
Origin species:
Oropouche virus
Uniprot ID:
NP_982303.1

Original price was: €253.00.Current price is: €228.00.

50ug 10% OFF + 228 loyalty points
His17–Asn208 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Oropouche virus/OROV Glycoprotein G2, C-His

Product name ARO-P18056-100
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Eukaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18056
Note For research use only.
Molecular Constructor
His17–Asn208 His
Product name ARO-P18056-1MG
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Eukaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18056
Note For research use only.
Molecular Constructor
His17–Asn208 His
Product name ARO-P18056-50
Uniprot ID NP_982303.1
Origin species Oropouche virus
Expression system Eukaryotic expression
Raw Antigen Sequence HPLSTSQIGDRCFAGGNLFKEMNLSVGLGEICVKDDISIVKSTTVFSKNKPALEATTKFYRSFIVKDWSECNPVLDKFGNFMVLSVDDNGHIIPKMYTCRAACDIRLNKDNAEIILSSTKLNHFEIVGTTSTSGWFKNTITNNLEHTCEHVTVNCGQKSVKFHACFRQHRGCIRFFKGTYMPYSMIEAMCVN
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type His17-Asn208
Aliases /Synonyms Envelopment polyprotein, M polyprotein, G2
Reference ARO-P18056
Note For research use only.
Molecular Constructor
His17–Asn208 His

There are no reviews yet.

Be the first to review “Oropouche virus/OROV Glycoprotein G2, C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products