Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
scFv-kappa-heavy

Original price was: €190.00.Current price is: €140.00.

50ug 26% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

Product name Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody
Product name PX-TA1171-50
Uniprot ID P16422
Source CAS 945228-48-8
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Oportuzumab,VB4-845,EPCAM, CD326,anti-EPCAM, CD326
Reference PX-TA1171
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype scFv-kappa-heavy
Clonality Monoclonal Antibody

Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade Introduction

Oportuzumab Biosimilar is a monoclonal antibody (mAb) that specifically targets the epithelial cell adhesion molecule (EPCAM), also known as CD326. This mAb is considered a biosimilar, meaning it is highly similar to a previously approved reference product, in this case, oportuzumab. Oportuzumab Biosimilar has been developed for research purposes and is not yet approved for therapeutic use.

Structure

Oportuzumab Biosimilar is a humanized IgG1 monoclonal antibody, meaning it is composed of human antibody sequences with a small portion of non-human sequences. It has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains have two constant regions (CL) and one variable region (VL). The variable regions of the antibody are responsible for binding to the target EPCAM protein.

Activity

Oportuzumab Biosimilar binds to EPCAM with high affinity and specificity, making it a potent inhibitor of EPCAM signaling. EPCAM is a transmembrane glycoprotein that is overexpressed in many types of cancer, including breast, colon, lung, and pancreatic cancer. It plays a crucial role in cell adhesion, migration, and proliferation, making it an attractive therapeutic target.

By binding to EPCAM, Oportuzumab Biosimilar blocks the interaction between EPCAM and its ligand, resulting in inhibition of downstream signaling pathways. This leads to decreased cell proliferation, migration, and invasion, ultimately leading to cell death. In addition, Oportuzumab Biosimilar has been shown to induce antibody-dependent cellular cytotoxicity (ADCC), where immune cells are activated to kill cancer cells that are bound by the antibody.

Application

Oportuzumab Biosimilar is primarily used in research settings to study the role of EPCAM in cancer and to evaluate its potential as a therapeutic target. It has been used in preclinical studies to investigate its efficacy in various cancer models, including breast, colon, and pancreatic cancer. In addition, Oportuzumab Biosimilar has also been used in combination with other cancer therapies, such as chemotherapy and radiation, to enhance their effectiveness.

Furthermore, Oportuzumab Biosimilar has the potential to be developed as a therapeutic antibody for the treatment of EPCAM-positive cancers. Clinical trials are currently underway to evaluate its safety and efficacy in patients with advanced EPCAM-positive breast cancer. If successful, Oportuzumab Biosimilar could provide a new treatment option for patients with limited treatment options and potentially improve their outcomes.

Conclusion

Oportuzumab Biosimilar is a promising monoclonal antibody that specifically targets EPCAM, a protein overexpressed in many types of cancer. Its structure, activity, and potential applications make it a valuable tool for studying the role of EPCAM in cancer and for potentially developing it as a therapeutic antibody. Further research and clinical trials are needed to fully understand the potential of Oportuzumab Biosimilar in the fight against cancer.

Oportuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade

There are no reviews yet.

Be the first to review “Oportuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products