Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Opinercept Biosimilar – Anti-TNF fusion protein – Research Grade

Uniprot ID:
P01375

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade

Product name Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2020-50
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)

Opinercept Biosimilar – Anti-TNF Fusion Protein Opinercept Biosimilar – Anti-TNF Fusion Protein: A Revolutionary Therapeutic Antibody Introduction

Opinercept Biosimilar is a novel anti-TNF fusion protein that has shown promising results in the treatment of various inflammatory and autoimmune diseases. This biosimilar is a highly effective and safe alternative to currently available anti-TNF therapies, providing a new option for patients and healthcare providers.

Structure of Opinercept Biosimilar

Opinercept Biosimilar is a fusion protein that is composed of two components – a human IgG1 Fc region and a soluble TNF receptor 2 (sTNFR2) domain. This unique structure allows Opinercept Biosimilar to specifically target and inhibit the activity of TNF, a key cytokine involved in the pathogenesis of various inflammatory diseases.

The human IgG1 Fc region provides Opinercept Biosimilar with a long half-life and increased stability, ensuring a sustained therapeutic effect. On the other hand, the sTNFR2 domain acts as a decoy receptor, binding to TNF and preventing it from interacting with its cell surface receptors, thereby inhibiting its pro-inflammatory effects.

Mechanism of Action

Opinercept Biosimilar works by blocking the activity of TNF, a cytokine that plays a crucial role in the development and progression of inflammatory and autoimmune diseases. TNF is known to promote inflammation, tissue damage, and joint destruction, making it a prime therapeutic target for these conditions.

By binding to TNF, Opinercept Biosimilar prevents it from binding to its cell surface receptors and initiating its downstream signaling pathways. This leads to a decrease in the production of pro-inflammatory cytokines and chemokines, reducing inflammation and providing relief from symptoms.

Applications of Opinercept Biosimilar

Opinercept Biosimilar has been extensively studied and has shown promising results in the treatment of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn’s disease.

In clinical trials, Opinercept Biosimilar has demonstrated significant improvements in disease activity, physical function, and quality of life in patients with these conditions. It has also shown a favorable safety profile, with minimal adverse effects reported.

Research Grade Opinercept Biosimilar

Opinercept Biosimilar is available in a research grade, making it an ideal tool for scientific studies and preclinical research. The high purity and potency of this biosimilar make it a valuable asset for studying the mechanisms of TNF inhibition and its effects on various disease models.

Research grade Opinercept Biosimilar can also be used to develop and optimize new therapeutic approaches for inflammatory and autoimmune diseases, providing a cost-effective and reliable option for researchers.

Conclusion

Opinercept Biosimilar is a revolutionary anti-TNF fusion protein that offers a new and effective treatment option for patients with inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a highly potent and safe therapeutic antibody. With its potential to improve patient outcomes and its applications in research, Opinercept Biosimilar is a promising addition to the arsenal of anti-TNF therapies.

Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Opinercept Biosimilar – Anti-TNF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products