Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Namilumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Namilumab ELISA Kit

Namilumab ELISA Kit

Product name Namilumab ELISA Kit
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX141
Note For research use only.
Sample type Plasma, Serum
Target Namilumab
Immunogen Namilumab

Introduction

Namilumab is a human monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various autoimmune diseases. It specifically targets the cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF), which plays a critical role in the pathogenesis of these diseases. The Namilumab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Namilumab in biological samples. In this article, we will discuss the structure, activity, and application of the Namilumab ELISA Kit in detail.

Structure of Namilumab

Namilumab is a fully human monoclonal antibody, meaning it is derived from human cells and has a high affinity for its target antigen, GM-CSF. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions are responsible for binding to GM-CSF, while the constant regions provide stability and effector functions. The molecular weight of Namilumab is approximately 150 kDa.

Activity of Namilumab

Namilumab exerts its therapeutic effect by binding to GM-CSF and preventing it from binding to its receptor on immune cells. This blocks the signaling pathway that leads to the production of pro-inflammatory cytokines, such as tumor necrosis factor-alpha (TNF-α) and interleukin-1 (IL-1). By inhibiting the activity of these cytokines, Namilumab reduces inflammation and tissue damage in autoimmune diseases.

Application of Namilumab ELISA Kit

The Namilumab ELISA Kit is a valuable tool for researchers and clinicians studying the pharmacokinetics and pharmacodynamics of Namilumab. It allows for the accurate and sensitive measurement of Namilumab levels in various biological samples, such as serum, plasma, and tissue homogenates. This information can be used to optimize dosing regimens and monitor treatment efficacy.

The Namilumab ELISA Kit is also useful in clinical trials for assessing the safety and efficacy of Namilumab in patients with autoimmune diseases. It can be used to measure Namilumab levels in patient samples and correlate them with clinical outcomes. This helps in understanding the relationship between Namilumab concentration and disease activity, as well as identifying potential biomarkers for treatment response.

Advantages of Namilumab ELISA Kit

Compared to other methods of Namilumab detection, such as Western blotting and flow cytometry, the Namilumab ELISA Kit offers several advantages. It is a highly sensitive and specific assay, with a detection limit of 0.1 ng/mL. This allows for the detection of even low levels of Namilumab in biological samples. The ELISA format also allows for high-throughput analysis, making it suitable for large-scale studies.

In addition, the Namilumab ELISA Kit is easy to use and does not require specialized equipment. It can be performed in a standard laboratory setting, and the results can be obtained within a few hours. The kit also comes with all the necessary reagents and controls, ensuring accurate and reproducible results.

Conclusion

In summary, the Namilumab ELISA Kit is a valuable tool for the detection and quantification of Namilumab in biological samples. Its high sensitivity, specificity, and ease of use make it an ideal choice for researchers and clinicians studying the role of Namilumab in autoimmune diseases. With the increasing interest in GM-CSF as a therapeutic target, the Namilumab ELISA Kit is expected to play a crucial role in the development and monitoring of Namilumab-based therapies.

Namilumab ELISA Kit

There are no reviews yet.

Be the first to review “Namilumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products