Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mycobacterium Nudix Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Mycobacterium
Uniprot ID:
A0QTS4
Molecular weight:
35,47 kDa

Original price was: €287.00.Current price is: €259.00.

50ug 10% OFF + 259 loyalty points
Full-length Yes
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mycobacterium Nudix Recombinant Protein

Product name Mycobacterium Nudix Recombinant Protein
Uniprot ID A0QTS4
Uniprot link http://www.uniprot.org/uniprot/A0QTS4
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MSEHRTFGLRNVPLLSRVGADRADTLRTDVDAALAGWPDALVLRVDRRNQVLIANGQVVLGEAGALGDRPPEHAVFLGRLQDGRHVWGIRADLEAPEDADLGTEVLDLRRAGQIFDDTSAQLVATATALLNWHDNARHSAIDGAPTRPAKGGWSRVNPLTGHEEFPRIDPAIICLVHDGHDRAVLARQTLWPERLFSILAGFVEAGESFETCVQREIAEEIGLTVTDVQYLGSQPWPFPRSLMVGFHAIGDPEQPFSYNDGEIAEAAWFTRDEIRAALDQGDWNSDSPSRLLLPGSISIAREIIESWAALD
Molecular weight 35,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM, Urea 8M if denaturing conditions. PBS, imidazole 200mM if dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession YP_886312.1
Spec:Entrez GeneID 4531751
Spec:SwissProtID A0QTS4
NCBI Reference YP_886312.1
Aliases /Synonyms Nudix, nudC gene product
Reference PX-P1132
Note For research use only
Molecular Constructor
Full-length Yes
Product name Mycobacterium Nudix Recombinant Protein
Uniprot ID A0QTS4
Uniprot link http://www.uniprot.org/uniprot/A0QTS4
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MSEHRTFGLRNVPLLSRVGADRADTLRTDVDAALAGWPDALVLRVDRRNQVLIANGQVVLGEAGALGDRPPEHAVFLGRLQDGRHVWGIRADLEAPEDADLGTEVLDLRRAGQIFDDTSAQLVATATALLNWHDNARHSAIDGAPTRPAKGGWSRVNPLTGHEEFPRIDPAIICLVHDGHDRAVLARQTLWPERLFSILAGFVEAGESFETCVQREIAEEIGLTVTDVQYLGSQPWPFPRSLMVGFHAIGDPEQPFSYNDGEIAEAAWFTRDEIRAALDQGDWNSDSPSRLLLPGSISIAREIIESWAALD
Molecular weight 35,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM, Urea 8M if denaturing conditions. PBS, imidazole 200mM if dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession YP_886312.1
Spec:Entrez GeneID 4531751
Spec:SwissProtID A0QTS4
NCBI Reference YP_886312.1
Aliases /Synonyms Nudix, nudC gene product
Reference PX-P1132
Note For research use only
Molecular Constructor
Full-length Yes
Product name PX-P1132-1MG
Uniprot ID A0QTS4
Uniprot link http://www.uniprot.org/uniprot/A0QTS4
Origin species Mycobacterium
Expression system Prokaryotic expression
Raw Antigen Sequence MSEHRTFGLRNVPLLSRVGADRADTLRTDVDAALAGWPDALVLRVDRRNQVLIANGQVVLGEAGALGDRPPEHAVFLGRLQDGRHVWGIRADLEAPEDADLGTEVLDLRRAGQIFDDTSAQLVATATALLNWHDNARHSAIDGAPTRPAKGGWSRVNPLTGHEEFPRIDPAIICLVHDGHDRAVLARQTLWPERLFSILAGFVEAGESFETCVQREIAEEIGLTVTDVQYLGSQPWPFPRSLMVGFHAIGDPEQPFSYNDGEIAEAAWFTRDEIRAALDQGDWNSDSPSRLLLPGSISIAREIIESWAALD
Molecular weight 35,47 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 300mM, Urea 8M if denaturing conditions. PBS, imidazole 200mM if dialysis
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession YP_886312.1
Spec:Entrez GeneID 4531751
Spec:SwissProtID A0QTS4
NCBI Reference YP_886312.1
Aliases /Synonyms Nudix, nudC gene product
Reference PX-P1132
Note For research use only
Molecular Constructor
Full-length Yes

Mycobacterium Nudix Recombinant Protein

There are no reviews yet.

Be the first to review “Mycobacterium Nudix Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products