Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MPV15 Fusion glycoprotein F0, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
murine pneumonia virus
Uniprot ID:
P35949

Original price was: €264.00.Current price is: €228.00.

50ug 14% OFF + 228 loyalty points
GST Asn22–Arg101 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

MPV15 Fusion glycoprotein F0, N-GST & C-His

Product name ARO-P18061-100
Uniprot ID P35949
Origin species murine pneumonia virus
Expression system Prokaryotic expression
Raw Antigen Sequence NTLTEKYYESTCSVETAGYKSALRTGWHMTVMSIKLSQINIESCKSSNSLLAHELAIYSSAVDELRTLSSNALKSKRKKR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Arg101
Aliases /Synonyms Fusion glycoprotein F0, Fusion glycoprotein F2, Fusion glycoprotein F1, F
Reference ARO-P18061
Note For research use only.
Molecular Constructor
GST Asn22–Arg101 His
Product name ARO-P18061-1MG
Uniprot ID P35949
Origin species murine pneumonia virus
Expression system Prokaryotic expression
Raw Antigen Sequence NTLTEKYYESTCSVETAGYKSALRTGWHMTVMSIKLSQINIESCKSSNSLLAHELAIYSSAVDELRTLSSNALKSKRKKR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Arg101
Aliases /Synonyms Fusion glycoprotein F0, Fusion glycoprotein F2, Fusion glycoprotein F1, F
Reference ARO-P18061
Note For research use only.
Molecular Constructor
GST Asn22–Arg101 His
Product name ARO-P18061-50
Uniprot ID P35949
Origin species murine pneumonia virus
Expression system Prokaryotic expression
Raw Antigen Sequence NTLTEKYYESTCSVETAGYKSALRTGWHMTVMSIKLSQINIESCKSSNSLLAHELAIYSSAVDELRTLSSNALKSKRKKR
Protein delivered with Tag? N-Terminal GST and C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn22-Arg101
Aliases /Synonyms Fusion glycoprotein F0, Fusion glycoprotein F2, Fusion glycoprotein F1, F
Reference ARO-P18061
Note For research use only.
Molecular Constructor
GST Asn22–Arg101 His

SDS-PAGE for MPV15 Fusion glycoprotein F0, N-GST & C-His

SDS-PAGE for MPV15 Fusion glycoprotein F0, N-GST & C-His

MPV15 Fusion glycoprotein F0, N-GST & C-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “MPV15 Fusion glycoprotein F0, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products