Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Mouse ENO1 Recombinant Protein |
---|---|
Uniprot ID | P17182 |
Uniprot link | http://www.uniprot.org/uniprot/P17182 |
Origin species | House Mouse |
Expression system | Prokaryotic expression |
Sequence | MGHHHHHHHHHHSSGHIEGRHMMSILRIHAREIFDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDNDKTRFM GKGVSQAVEHINKTIAPALVSKKVNVVEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLA GNPEVILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFREAMRIGAEVYHNLKNVIKEKYGKDATNVGDEGGFAPNIL ENKEALELLKTAIAKAGYTDQVVIGMDVAASEFYRSGKYDLDFKSPDDPSRYITPDQLADLYKSFVQNYPVVSIEDPFDQ DDWGAWQKFTASAGIQVVGDDLTVTNPKRIAKAASEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETED TFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAKFAGRSFRNPLAKDYLDDDDL |
Molecular weight | 50,68 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Full-length |
Protein Accession | NP_075608 |
Spec:Entrez GeneID | 13806 |
Spec:NCBI Gene Aliases | MBP-1, AL022784, 0610008I15, Eno-1 |
Spec:SwissProtID | P17182 |
NCBI Reference | NP_075608 |
Aliases /Synonyms | ENO1 Protein, Alpha Enolase Protein, Alpha enolase like 1 Protein, ENO1L1 Protein, Enolase 1 Protein, MBP-1 Protein, MBPB1 Protein, MPB1 Protein, MYC promoter-binding protein 1 Protein, NNE Protein, Phosphopyruvate hydratase Protein, Alpha-enolase Protein, Tau-crystallin Protein, MBP1 Protein, MPB-1 Protein, C-myc promoter-binding protein Protein, Enolase 1, (alpha) Protein, Enolase-alpha Protein, Non-neural enolase Protein, Plasminogen-binding protein Protein, PPH Protein |
Reference | PX-P1088 |
Note | For research use only |
Enolase 1 (ENO1), commonly known as alpha-enolase is a glycolytic enzyme, one of three enolase isoenzymes found in mammals. Every isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. ENO1 is a glycolytic enzyme that catalyzes the conversion of 2-phosphoglycerate to phosphoenolpyruvate. This isozyme is ubiquitously expressed in adult human tissues, including liver, brain, kidney, and spleen. It is a multifunctional enzyme that plays a part in the glycolysis and in various processes such as growth control, hypoxia tolerance and allergic responses. It can also work in the intravascular and pericellular fibrinolytic system because to its capability to serve as a receptor and activator of plasminogen on the cell surface of several cell-types such as leukocytes and neurons.
Publication
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.