Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse EGF recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P01132
Molecular weight:
37.12 kDa

Original price was: €91.00.Current price is: €83.00.

50ug 9% OFF + 83 loyalty points
Asn977–Arg1029 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse EGF recombinant protein

Mouse EGF recombinant protein

Product name PX-P6432-100
Uniprot ID P01132
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Molecular weight 37.12 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn977-Arg1029
Aliases /Synonyms EGF, Epidermal growth factor, EgfPro-epidermal growth factor,
Reference PX-P6432
Molecular Constructor
Asn977–Arg1029 Fc
Product name PX-P6432-1MG
Uniprot ID P01132
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Molecular weight 37.12 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn977-Arg1029
Aliases /Synonyms EGF, Epidermal growth factor, EgfPro-epidermal growth factor,
Reference PX-P6432
Molecular Constructor
Asn977–Arg1029 Fc
Product name PX-P6432-50
Uniprot ID P01132
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
Molecular weight 37.12 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Asn977-Arg1029
Aliases /Synonyms EGF, Epidermal growth factor, EgfPro-epidermal growth factor,
Reference PX-P6432
Molecular Constructor
Asn977–Arg1029 Fc

Mouse EGF recombinant protein

There are no reviews yet.

Be the first to review “Mouse EGF recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products