Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CXCL1 Recombinant Protein, N-GST&C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P12850

Original price was: €262.00.Current price is: €228.00.

50ug 13% OFF + 228 loyalty points
GSTandC-Terminal His Ser19–Lys96
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CXCL1 Recombinant Protein, N-GST&C-His

Product name ARO-P18374-100
Uniprot ID P12850
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Lys96
Aliases /Synonyms Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51; KC(5-72); Hematopoietic synergistic factor; HSF; KC-T; Cxcl1; Gro; Gro1; Mgsa; Scyb1
Reference ARO-P18374
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Ser19–Lys96
Product name ARO-P18374-1MG
Uniprot ID P12850
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Lys96
Aliases /Synonyms Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51; KC(5-72); Hematopoietic synergistic factor; HSF; KC-T; Cxcl1; Gro; Gro1; Mgsa; Scyb1
Reference ARO-P18374
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Ser19–Lys96
Product name ARO-P18374-50
Uniprot ID P12850
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence SRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Protein delivered with Tag? N-Terminal GSTandC-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser19-Lys96
Aliases /Synonyms Growth-regulated alpha protein; C-X-C motif chemokine 1; Platelet-derived growth factor-inducible protein KC; Secretory protein N51; KC(5-72); Hematopoietic synergistic factor; HSF; KC-T; Cxcl1; Gro; Gro1; Mgsa; Scyb1
Reference ARO-P18374
Note For research use only.
Molecular Constructor
GSTandC-Terminal His Ser19–Lys96

There are no reviews yet.

Be the first to review “Mouse CXCL1 Recombinant Protein, N-GST&C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products