Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD157 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q64277
Molecular weight:
32.37 kDa

Original price was: €288.00.Current price is: €223.00.

50ug 23% OFF + 223 loyalty points
Ala25–Glu285 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CD157 recombinant protein

Mouse CD157 recombinant protein

Product name PX-P6403-100
Uniprot ID Q64277
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRE
Molecular weight 32.37 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Glu285
Aliases /Synonyms 3.2.2.6, ADP-ribosyl cyclase 2, Antigen BP3, BP-3 alloantigen, Bone marrow stromal antigen 1, BST-1, Cyclic ADP-ribose hydrolase 2, cADPr hydrolase 2, Leukocyte antigen 65, Ly-65, CD157, Bst1, Bp-3, Bp3, Ly65ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2,
Reference PX-P6403
Molecular Constructor
Ala25–Glu285 His
Product name PX-P6403-1MG
Uniprot ID Q64277
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRE
Molecular weight 32.37 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Glu285
Aliases /Synonyms 3.2.2.6, ADP-ribosyl cyclase 2, Antigen BP3, BP-3 alloantigen, Bone marrow stromal antigen 1, BST-1, Cyclic ADP-ribose hydrolase 2, cADPr hydrolase 2, Leukocyte antigen 65, Ly-65, CD157, Bst1, Bp-3, Bp3, Ly65ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2,
Reference PX-P6403
Molecular Constructor
Ala25–Glu285 His
Product name PX-P6403-50
Uniprot ID Q64277
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence ARARWRGEGTTPHLQSIFLGRCAEYTTLLSLGNKNCTAIWEAFKGVLDKDPCSVLPSDYDLFINLSRHPIPRDKSLFWENNHLLVMSYGENTRRLVALCDVLYGKVGDFLSWCRQENASGLDYQSCPTSEDCENNAVDSYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTRGFFADFEIPYLQKDKVTRIEIWVMHDVGGPNVESCGEGSVKILEDRLEALGFQHSCINDYRPVKFLMCVDHSTHPDCIMNSASASMRRE
Molecular weight 32.37 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Glu285
Aliases /Synonyms 3.2.2.6, ADP-ribosyl cyclase 2, Antigen BP3, BP-3 alloantigen, Bone marrow stromal antigen 1, BST-1, Cyclic ADP-ribose hydrolase 2, cADPr hydrolase 2, Leukocyte antigen 65, Ly-65, CD157, Bst1, Bp-3, Bp3, Ly65ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2,
Reference PX-P6403
Molecular Constructor
Ala25–Glu285 His

Mouse CD157 recombinant protein

There are no reviews yet.

Be the first to review “Mouse CD157 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products