Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse CD147/BSG Recombinant Protein, C-His

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
P18572
Molecular weight:
36.26 kDa

Original price was: €264.00.Current price is: €228.00.

50ug 14% OFF + 228 loyalty points
Ala22–Arg325 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse CD147/BSG Recombinant Protein, C-His

Product name ARO-P21027-100
Uniprot ID P18572
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 36.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Arg325
Aliases /Synonyms 5F7, BSG, Basigin, CD147, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, HAb18G, Hepatoma-associated antigen, Leukocyte activation antigen M6, OK blood group antigen, TCSF, Tumor cell-derived collagenase stimulatory factor
Reference ARO-P21027
Note For research use only.
Molecular Constructor
Ala22–Arg325 His
Product name ARO-P21027-1MG
Uniprot ID P18572
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 36.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Arg325
Aliases /Synonyms 5F7, BSG, Basigin, CD147, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, HAb18G, Hepatoma-associated antigen, Leukocyte activation antigen M6, OK blood group antigen, TCSF, Tumor cell-derived collagenase stimulatory factor
Reference ARO-P21027
Note For research use only.
Molecular Constructor
Ala22–Arg325 His
Product name ARO-P21027-50
Uniprot ID P18572
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Molecular weight 36.26 kDa
Protein delivered with Tag? C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala22-Arg325
Aliases /Synonyms 5F7, BSG, Basigin, CD147, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, HAb18G, Hepatoma-associated antigen, Leukocyte activation antigen M6, OK blood group antigen, TCSF, Tumor cell-derived collagenase stimulatory factor
Reference ARO-P21027
Note For research use only.
Molecular Constructor
Ala22–Arg325 His

There are no reviews yet.

Be the first to review “Mouse CD147/BSG Recombinant Protein, C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products