Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Mouse CASP7 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P97864

Original price was: €251.00.Current price is: €228.00.

50ug 9% OFF + 228 loyalty points
His Ala24–Arg303
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mouse CASP7 Recombinant Protein, N-His

Mouse CASP7 Recombinant Protein, N-His

Product name ARO-P18433-100
Uniprot ID P97864
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLYRMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Arg303
Aliases /Synonyms Caspase-7, CASP-7, EC:3.4.22.60, Apoptotic protease Mch-3, Cysteine protease LICE2, Caspase-7 subunit p20, Caspase-7 subunit p11, Casp7, Lice2, Mch3
Reference ARO-P18433
Note For research use only.
Molecular Constructor
His Ala24–Arg303
Product name ARO-P18433-1MG
Uniprot ID P97864
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLYRMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Arg303
Aliases /Synonyms Caspase-7, CASP-7, EC:3.4.22.60, Apoptotic protease Mch-3, Cysteine protease LICE2, Caspase-7 subunit p20, Caspase-7 subunit p11, Casp7, Lice2, Mch3
Reference ARO-P18433
Note For research use only.
Molecular Constructor
His Ala24–Arg303
Product name ARO-P18433-50
Uniprot ID P97864
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLYRMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala24-Arg303
Aliases /Synonyms Caspase-7, CASP-7, EC:3.4.22.60, Apoptotic protease Mch-3, Cysteine protease LICE2, Caspase-7 subunit p20, Caspase-7 subunit p11, Casp7, Lice2, Mch3
Reference ARO-P18433
Note For research use only.
Molecular Constructor
His Ala24–Arg303

There are no reviews yet.

Be the first to review “Mouse CASP7 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products