Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Monkeypox virus (strain Zaire-96-I-16) (MPX) Monkeypox virus (MPXV) H3L recombinant protein

Host species:
Mammalian cells
Origin species:
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Uniprot ID:
A0A7H0DN80
Molecular weight:
60.89 kDa

Original price was: €282.00.Current price is: €254.00.

50ug 10% OFF + 254 loyalty points
Ala2–Phe282 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Monkeypox virus (strain Zaire-96-I-16) (MPX) Monkeypox virus (MPXV) H3L  recombinant protein

Monkeypox virus (strain Zaire-96-I-16) (MPX) Monkeypox virus (MPXV) H3L recombinant protein

Product name PX-P6453-100
Uniprot ID A0A7H0DN80
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Eukaryotic expression
Raw Antigen Sequence AAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFTELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISF
Molecular weight 60.89 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Phe282
Aliases /Synonyms H3L, Monkeypox virus (strain Zaire-96-I-16) (MPX)H3L, clade1b
Reference PX-P6453
Molecular Constructor
Ala2–Phe282 Fc
Product name PX-P6453-1MG
Uniprot ID A0A7H0DN80
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Eukaryotic expression
Raw Antigen Sequence AAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFTELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISF
Molecular weight 60.89 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Phe282
Aliases /Synonyms H3L, Monkeypox virus (strain Zaire-96-I-16) (MPX)H3L, clade1b
Reference PX-P6453
Molecular Constructor
Ala2–Phe282 Fc
Product name PX-P6453-50
Uniprot ID A0A7H0DN80
Origin species Monkeypox virus (strain Zaire-96-I-16) (MPX)
Expression system Eukaryotic expression
Raw Antigen Sequence AAVKTPVIVVPVIDRPPSETFPNVHEHINDQKFDDVKDNEVMQEKRDVVIVNDDPDHYKDYVFIQWTGGNIRDDDKYTHFFSGFCNTMCTEETKRNIARHLALWDSKFFTELENKNVEYVVIIENDNVIEDITFLRPVLKAIHDKKIDILQMREIITGNKVKTELVIDKDHAIFTYTGGYDVSLSAYIIRVTTALNIVDEIIKSGGLSSGFYFEIARIENEMKINRQIMDNSAKYVEHDPRLVAEHRFETMKPNFWSRIGTVAAKRYPGVMYTFTTPLISF
Molecular weight 60.89 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala2-Phe282
Aliases /Synonyms H3L, Monkeypox virus (strain Zaire-96-I-16) (MPX)H3L, clade1b
Reference PX-P6453
Molecular Constructor
Ala2–Phe282 Fc

Monkeypox virus (strain Zaire-96-I-16) (MPX) Monkeypox virus (MPXV) H3L  recombinant protein

There are no reviews yet.

Be the first to review “Monkeypox virus (strain Zaire-96-I-16) (MPX) Monkeypox virus (MPXV) H3L recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products