Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Mite allergen Blo t 5(BLOT5)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Mite allergen Blo t 5(BLOT5) |
|---|---|
| Uniprot ID | O96870 |
| Uniprot link | https://www.uniprot.org/uniprot/O96870 |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGLEVLFQGPQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ |
| Molecular weight | 16.22KDa |
| Purity estimated | 90% by SDS-PAGE |
| Buffer | 50 mM Tris-HCl pH 8.0, 150 mMNaCl |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln18-Gln134 |
| Aliases /Synonyms | BLOT5/Mite allergen Blo t |
| Reference | PX-P4389 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.