Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirvetuximab ELISA Kit

€1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirvetuximab ELISA Kit

Mirvetuximab ELISA Kit

Product name Mirvetuximab ELISA Kit
Uniprot ID P15328
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX186
Note For research use only.
Sample type Plasma, Serum
Target Mirvetuximab
Immunogen Mirvetuximab

The Structure and

Activity of Mirvetuximab ELISA Kit

Mirvetuximab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection of Mirvetuximab, a monoclonal antibody targeting folate receptor alpha (FRα). This kit is designed to accurately measure the levels of Mirvetuximab in various biological samples such as serum, plasma, and cell culture supernatants.

Structure of Mirvetuximab

Mirvetuximab is a humanized monoclonal antibody composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains contain only a variable region. The variable regions of both heavy and light chains are responsible for binding to FRα, the therapeutic target of Mirvetuximab.

The constant regions of Mirvetuximab are derived from human IgG1, which provides stability and allows for efficient binding to Fc receptors on immune cells. This enables Mirvetuximab to elicit immune-mediated anti-tumor effects in addition to its direct anti- cancer activity.

Activity of Mirvetuximab

Mirvetuximab specifically targets FRα, a protein that is overexpressed in many types of cancer, including ovarian, lung, and breast cancer. FRα is involved in cell growth and proliferation, making it an attractive therapeutic target for cancer treatment.

Upon binding to FRα, Mirvetuximab blocks the receptor’s function, leading to inhibition of tumor cell growth and induction of cell death. In addition, Mirvetuximab can also activate the immune system to recognize and attack cancer cells expressing FRα, further enhancing its anti-tumor activity.

Application of Mirvetuximab ELISA Kit

The Mirvetuximab ELISA Kit is a valuable tool for monitoring the levels of Mirvetuximab in patients receiving treatment with this antibody. It can also be used to measure the levels of Mirvetuximab in preclinical studies, providing important information on the pharmacokinetics and pharmacodynamics of this therapeutic agent.

Furthermore, the Mirvetuximab ELISA Kit can be used to assess the presence of Mirvetuximab in biological samples from patients enrolled in clinical trials, allowing for the evaluation of treatment efficacy and potential adverse effects. This information is crucial for the development and optimization of Mirvetuximab-based therapies.

In summary, the Mirvetuximab ELISA Kit is a reliable and sensitive diagnostic tool for the detection of Mirvetuximab, a promising antibody targeting FRα in cancer treatment. Its accurate measurement of Mirvetuximab levels can aid in the monitoring and evaluation of treatment response, ultimately leading to improved outcomes for cancer patients.

Mirvetuximab ELISA Kit

There are no reviews yet.

Be the first to review “Mirvetuximab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products