Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Milatuzumab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Milatuzumab ELISA Kit

Milatuzumab ELISA Kit

Product name Milatuzumab ELISA Kit
Uniprot ID P04233
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX143
Note For research use only.
Sample type Plasma, Serum
Target Milatuzumab
Immunogen Milatuzumab

Introduction

Milatuzumab is a humanized monoclonal antibody that targets the CD74 receptor, a protein that is overexpressed in various types of cancer cells. This antibody has shown promising results in pre-clinical and clinical studies, making it a potential therapeutic target for cancer treatment. The Milatuzumab ELISA Kit is a valuable tool for detecting and quantifying this antibody in biological samples, providing researchers with important insights into its structure, activity, and potential applications.

Structure of Milatuzumab

Milatuzumab is a chimeric IgG1 antibody, meaning it contains both human and mouse components. It consists of two heavy chains and two light chains, each with a unique amino acid sequence that determines its binding specificity. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). The VH and VL domains come together to form the antigen-binding site, which recognizes and binds to the CD74 receptor.

Activity of Milatuzumab

The main mechanism of action of Milatuzumab is through its binding to the CD74 receptor, which is found on the surface of cancer cells. This binding blocks the interaction between CD74 and its ligand, MIF, leading to the inhibition of downstream signaling pathways that promote cancer cell survival and proliferation. In addition, Milatuzumab can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further contribute to its anti-tumor activity.

Applications of Milatuzumab ELISA Kit

The Milatuzumab ELISA Kit is a highly sensitive and specific assay that allows for the measurement of Milatuzumab levels in various biological samples, such as serum, plasma, and cell culture supernatants. This kit is useful for both pre-clinical and clinical studies, providing researchers with valuable information on the pharmacokinetics and pharmacodynamics of Milatuzumab. It can also be used to monitor the efficacy of Milatuzumab treatment in patients, as well as to assess the potential for drug-drug interactions.

Detection of Milatuzumab in

Cancer Patients

The Milatuzumab ELISA Kit has been used in several clinical studies to detect and quantify Milatuzumab levels in cancer patients. In a phase I clinical trial, the kit was used to measure Milatuzumab levels in the serum of patients with advanced solid tumors, and it was found that Milatuzumab had a half-life of approximately 10 days. In another study, the kit was used to monitor Milatuzumab levels in the serum of patients with multiple myeloma, and it was found that higher levels of Milatuzumab were associated with better clinical outcomes.

Conclusion

In summary, the Milatuzumab ELISA Kit is a valuable tool for detecting and quantifying Milatuzumab, a promising therapeutic antibody that targets the CD74 receptor. Its structure, activity, and applications make it a promising candidate for cancer treatment, and the Milatuzumab ELISA Kit provides researchers with important insights into its pharmacokinetics and pharmacodynamics. Further studies and clinical trials are needed to fully understand the potential of Milatuzumab as a therapeutic target for cancer.

Milatuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Milatuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products