Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

Product name Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1095-50
Uniprot ID P04233
Source CAS 899796-83-9
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
Molecular weight 147kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Milatuzumab,CD74-DOX (ADC),MEDI-115,hLL1,hLL1-DOX (ADC),CD74,anti-CD74
Reference PX-TA1095
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade Introduction

Milatuzumab Biosimilar is a monoclonal antibody (mAb) that targets the CD74 protein. It is a biosimilar version of the original Milatuzumab, which was developed and approved for clinical use in the treatment of B-cell malignancies. The biosimilar version has been designed to have the same structure, activity, and therapeutic potential as the original, but at a more affordable cost for research purposes.

Structure

Milatuzumab Biosimilar is a humanized IgG1 kappa monoclonal antibody, with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a constant region (Fc) and a variable region (Fab), with the Fab region responsible for binding to the CD74 protein.

Activity

The main activity of Milatuzumab Biosimilar is its ability to bind to the CD74 protein. CD74 is a cell surface protein that is overexpressed in various types of cancer, including B-cell malignancies. By binding to CD74, Milatuzumab Biosimilar can block its activity and inhibit the growth and survival of cancer cells. It can also trigger antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further enhance its anti- cancer effects.

Application

Milatuzumab Biosimilar has a wide range of potential applications in cancer research. It can be used as a tool for studying the role of CD74 in cancer development and progression. It can also be used to screen for potential therapeutic targets and to evaluate the efficacy of novel anti- cancer drugs. Additionally, Milatuzumab Biosimilar can be used in pre-clinical studies to assess its potential as a therapeutic agent for B-cell malignancies and other CD74-expressing cancers.

Therapeutic Target

The main therapeutic target of Milatuzumab Biosimilar is the CD74 protein. CD74 is a transmembrane protein that is involved in various cellular processes, including immune response, cell proliferation, and survival. It is overexpressed in many types of cancer and has been identified as a potential therapeutic target for cancer treatment. By targeting CD74, Milatuzumab Biosimilar can disrupt the signaling pathways that promote cancer cell growth and survival, leading to tumor regression and improved patient outcomes.

Conclusion

Milatuzumab Biosimilar is a promising research tool for studying the role of CD74 in cancer and evaluating its potential as a therapeutic target. Its similar structure and activity to the original Milatuzumab make it a cost-effective option for pre-clinical studies. With its ability to inhibit cancer cell growth and trigger immune-mediated cytotoxicity, Milatuzumab Biosimilar has the potential to be a valuable addition to the arsenal of anti- cancer therapies.

SDS-PAGE for Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

SDS-PAGE for Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Milatuzumab Biosimilar - Anti-CD74 mAb - Research Grade

There are no reviews yet.

Be the first to review “Milatuzumab Biosimilar – Anti-CD74 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products