Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

MERS-CoV nsp1 Recombinant Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV)
Uniprot ID:
K9N638

Original price was: €255.00.Current price is: €228.00.

50ug 11% OFF + 228 loyalty points
His Tyr16–Gly193
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
MERS-CoV nsp1 Recombinant Protein, N-His

MERS-CoV nsp1 Recombinant Protein, N-His

Product name ARO-P18622-100
Uniprot ID K9N638
Origin species Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV)
Expression system Prokaryotic expression
Raw Antigen Sequence YRAALNSEKHQDHVSLTVPLCGSGNLVEKLSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFMVNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHYERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr16-Gly193
Aliases /Synonyms Replicase polyprotein 1a, pp1a, ORF1a polyprotein, Host translation inhibitor nsp1, nsp1, Leader protein, Non-structural protein 2, nsp2, p65 homolog, Papain-like protease nsp3, PL-PRO, EC:3.4.19.12, EC:3.4.22.-, Non-structural protein 3, nsp3, PL2-PRO, Non-structural protein 4, nsp4, 3C-like proteinase nsp5, 3CL-PRO, 3CLp, EC:3.4.22.69, nsp5, Non-structural protein 6, nsp6, Non-structural protein 7, nsp7, Non-structural protein 8, nsp8, RNA-capping enzyme subunit nsp9, Non-structural protein 9, nsp9, EC:2.7.7.50, Non-structural protein 10, nsp10, Growth factor-like peptide, GFL, Non-structural protein 11, nsp11
Reference ARO-P18622
Note For research use only.
Molecular Constructor
His Tyr16–Gly193
Product name ARO-P18622-1MG
Uniprot ID K9N638
Origin species Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV)
Expression system Prokaryotic expression
Raw Antigen Sequence YRAALNSEKHQDHVSLTVPLCGSGNLVEKLSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFMVNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHYERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr16-Gly193
Aliases /Synonyms Replicase polyprotein 1a, pp1a, ORF1a polyprotein, Host translation inhibitor nsp1, nsp1, Leader protein, Non-structural protein 2, nsp2, p65 homolog, Papain-like protease nsp3, PL-PRO, EC:3.4.19.12, EC:3.4.22.-, Non-structural protein 3, nsp3, PL2-PRO, Non-structural protein 4, nsp4, 3C-like proteinase nsp5, 3CL-PRO, 3CLp, EC:3.4.22.69, nsp5, Non-structural protein 6, nsp6, Non-structural protein 7, nsp7, Non-structural protein 8, nsp8, RNA-capping enzyme subunit nsp9, Non-structural protein 9, nsp9, EC:2.7.7.50, Non-structural protein 10, nsp10, Growth factor-like peptide, GFL, Non-structural protein 11, nsp11
Reference ARO-P18622
Note For research use only.
Molecular Constructor
His Tyr16–Gly193
Product name ARO-P18622-50
Uniprot ID K9N638
Origin species Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (MERS-CoV)
Expression system Prokaryotic expression
Raw Antigen Sequence YRAALNSEKHQDHVSLTVPLCGSGNLVEKLSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFMVNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHYERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGG
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Tyr16-Gly193
Aliases /Synonyms Replicase polyprotein 1a, pp1a, ORF1a polyprotein, Host translation inhibitor nsp1, nsp1, Leader protein, Non-structural protein 2, nsp2, p65 homolog, Papain-like protease nsp3, PL-PRO, EC:3.4.19.12, EC:3.4.22.-, Non-structural protein 3, nsp3, PL2-PRO, Non-structural protein 4, nsp4, 3C-like proteinase nsp5, 3CL-PRO, 3CLp, EC:3.4.22.69, nsp5, Non-structural protein 6, nsp6, Non-structural protein 7, nsp7, Non-structural protein 8, nsp8, RNA-capping enzyme subunit nsp9, Non-structural protein 9, nsp9, EC:2.7.7.50, Non-structural protein 10, nsp10, Growth factor-like peptide, GFL, Non-structural protein 11, nsp11
Reference ARO-P18622
Note For research use only.
Molecular Constructor
His Tyr16–Gly193

There are no reviews yet.

Be the first to review “MERS-CoV nsp1 Recombinant Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products