Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

MCherry Protein – MCherry fluorescent protein(mCherry)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
X5DSL3

Original price was: €233.00.Current price is: €182.00.

50ug 22% OFF + 182 loyalty points
Met1–Lys236
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

MCherry Protein - MCherry fluorescent protein(mCherry)

Product name MCherry Protein - MCherry fluorescent protein(mCherry)
Uniprot ID X5DSL3
Uniprot link https://www.uniprot.org/uniprot/X5DSL3
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Purity estimated >61% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys236
Reference PX-P4612
Note For research use only
Molecular Constructor
Met1–Lys236
Product name MCherry Protein - MCherry fluorescent protein(mCherry)
Uniprot ID X5DSL3
Uniprot link https://www.uniprot.org/uniprot/X5DSL3
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Purity estimated >61% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys236
Reference PX-P4612
Note For research use only
Molecular Constructor
Met1–Lys236
Product name PX-P4612-1MG
Uniprot ID X5DSL3
Uniprot link https://www.uniprot.org/uniprot/X5DSL3
Expression system Prokaryotic expression
Raw Antigen Sequence MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Purity estimated >61% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys236
Reference PX-P4612
Note For research use only.
Molecular Constructor
Met1–Lys236

General information on MCherry protein

MCherry protein is a member of mFruits family of proteins which consists of monomeric red fluorescent proteins. These proteins are often used as tags to exploit different organelles using fluorescence spectroscopy. MCherry protein is capable of absorbing light between 540-50 nm and emits light in return in a wavelength range of 550-650 nm. MCherry protein has been used to visualize genes and further analyze their function. One main advantage of using fluorescent proteins such as mCherry and mRFPs, is that, because of their lower molecular weight, that have the tendency to fold fasters than tetramers. This results in monomeric fluorescent proteins that disturb the target less.

The structure of mCherry protein consists of 3 alpha helices and the beta barrel that is made of 13 beta sheets. Its chromophore contains three amino acids, glycine, methionine and tyrosine. These amino acids are post-translationally modified into imidazoline. The red-shifted absorbance and emission of mCherry protein is due to its extended p-electron conjugation.

MCherry protein can be used as an intracellular probe in fluorescence microscopy. However, possible interactions between the tagged protein and the fluorescent protein can disturb the targeting process or the function of the protein of interest. mCherry protein can be used as an acceptor for hetero-FRET (also known as fluorescence resonance energy transfer) and probe for homo-FRET experiments. FRET is a nonradiative phenomenon that consists of energy being transferred from the donor (fluorophore) to the acceptor (chromophore). The efficiency of this lab technique depends of the distance between the donor and the acceptor.
MCherry protein was developed in order to study bacterial gene expression in L.pneumophila, a Gram-negative pathogen responsible for the Legionnaire’s Disease. Because mCherry protein doesn’t interfere with other plasmids and doesn’t alter the intracellular, this protein has been frequently used for constitutive gene expression in a wide range of Gram-negative bacterial species.

MCherry Protein - MCherry fluorescent protein(mCherry)

  • Martin Puebla, 2023, California State University, The Characterization of Methionine-Enriched Phytohemagglutinin-E Protein in Phaseolus vulgaris

  • james.tyrrell — July 13, 2023

    Used for fluorescence microscopy – gave very useful results! Re-purchased for additional use.

Add a review

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products