Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Macrophage migration inhibitory factor(MIF)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P14174
Molecular weight:
13.41kDa

385.00

100ug | 50ug + 385 loyalty points
Met1–Ala115
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Macrophage migration inhibitory factor(MIF)

Product name MIF Protein - Macrophage migration inhibitory factor(MIF)
Uniprot ID P14174
Uniprot link https://www.uniprot.org/uniprot/P14174
Expression system Prokaryotic expression
Raw Antigen Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Molecular weight 13.41kDa
Purity estimated >80% by SDS-PAGE
Buffer 50 mM Tris-HCl, pH 7.5, 150 mM NaCl
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Ala115
Aliases /Synonyms GLIF, MMIF,Glycosylation-inhibiting factor、GIF、L-dopachrome isomerase、L-dopachrome tautomerase 、Phenylpyruvate tautomerase
Reference PX-P4589
Note For research use only
Molecular Constructor
Met1–Ala115

General information on MIF protein

MIF protein also known as macrophage migration inhibitory factor, glycosylation-inhibiting factor (GIF), phenylpyruvate or L-dopachrome is a protein encoded by MIF gene in humans. The protein is part of tautomerase superfamily of proteins. The proteins belonging to this superfamily are characterized by the utilization of N-terminal protein in their mechanism. Unlike many of the proteins part of this superfamily, MIF protein is not involved in cytokine activity. The protein is believed to mediate and regulate the function of macrophages in host defense and counteracts the anti-inflammatory activity of molecules such as glucocorticoids.
nnMIF protein is released upon stimulation of white blood cells by bacterial antigens. The MIF protein then binds to CD74 protein. The latter is a transmembrane molecule expressed by B-cells, mantle cells and particularly follicular center cells. The CD74-MIF protein complex triggers an acute immune response. Glucocorticoids also stimulate MIF protein release by acting on white blood cells. MIF protein may also be released following the activation of the anterior pituary gland as a result trauma.
nnMIF protein assembles into a trimer that consists of three identical subunits. Each monomer contain a four-stranded beta sheet and two antiparallel alpha helices. The monomers are located around a central channel with 3-fold rational symmetry.
nnMIF proteins contains two motifs responsible for its catalytic activity. One of the motifs has 27 amino acids and is located at the N-terminus of the protein chain. It functions as a phenylpyruvate tautomerase and catalyzes the conversion of 2-carboxy-2,3-dihydroindole-5,6-quinone (also known as dopachrome) into 5,6-dihydroxyindole-2-carboxylic acid (also known as DHICA). The other catalytic site is located between residues 57 and 60 and appears to act as a disulfide reductase. MIF protein has been reported to interact with a range of proteins such as BNIPL, CD74, COPS5, CXCR4 and RPS19. MIF protein has been considered as a potential drug target for cancer, sepsis and rheumatoid arthritis.

There are no reviews yet.

Be the first to review “Macrophage migration inhibitory factor(MIF)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products