Brand: ProteoGenix

LIV prM Recombinant Protein, N-GST & C-His

ARO-P18724-50
Quality Chart

Host species:: Escherichia coli (E.coli)
Origin species:: Louping ill virus (LIV)
Uniprot ID:: P22338

Original price was: €260.00.Current price is: €228.00.

50ug 12% OFF + 228 loyalty points

GST Thr118–Arg205 His

Size Size

50ug Original price was: €260.00.Current price is: €228.00.
100ug Original price was: €384.00.Current price is: €325.00.
1MG Original price was: €1,150.00.Current price is: €943.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

LIV prM Recombinant Protein, N-GST & C-His

Product name	ARO-P18724-100
Uniprot ID	P22338
Origin species	Louping ill virus (LIV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr118-Arg205
Aliases /Synonyms	Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference	ARO-P18724
Note	For research use only.
Molecular Constructor	GST Thr118–Arg205 His

Product name	ARO-P18724-1MG
Uniprot ID	P22338
Origin species	Louping ill virus (LIV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr118-Arg205
Aliases /Synonyms	Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference	ARO-P18724
Note	For research use only.
Molecular Constructor	GST Thr118–Arg205 His

Product name	ARO-P18724-50
Uniprot ID	P22338
Origin species	Louping ill virus (LIV)
Expression system	Prokaryotic expression
Raw Antigen Sequence	TVRKEGDGTTVIRAEGRDAATQVRVENGTCVILATDMGSWCDDSLSYECVTIEQGEEPVDVDCFCRNVDGVYLEYGRCGKQEGSRTRR
Protein delivered with Tag?	N-Terminal GST and C-Terminal His Tag
Buffer	Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form	Liquid
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Thr118-Arg205
Aliases /Synonyms	Genome polyprotein, Capsid protein C, Core protein, Protein prM, Peptide pr, Small envelope protein M, Matrix protein, Envelope protein E, Non-structural protein 1, NS1, Non-structural protein 2A, NS2A, Serine protease subunit NS2B, Flavivirin protease NS2B regulatory subunit, Non-structural protein 2B, Serine protease NS3, 3.4.21.91, 3.6.1.15, 3.6.4.13, Flavivirin protease NS3 catalytic subunit, Non-structural protein 3, Non-structural protein 4A, NS4A, Peptide 2k, Non-structural protein 4B, NS4B, RNA-directed RNA polymerase NS5, 2.1.1.56, 2.1.1.57, 2.7.7.48, Non-structural protein 5
Reference	ARO-P18724
Note	For research use only.
Molecular Constructor	GST Thr118–Arg205 His