Skip to main content
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameLipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein
Uniprot IDQ6A601
Uniprot linkhttp://www.uniprot.org/uniprot/Q6A601
Origin speciesPropionibacterium acnes
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA
Molecular weight34,73 kDa
Protein delivered with Tag?Yes
Purity estimated>95%
BufferPBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions
Formliquid
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition

Lipase protein is stored:


At 4°C for short term period (less than a week)
At -20°C or -80°C for long term period

Recommendations


It is important to avoid avoid freezing/thawing cycles
20-40% glycerol may be added to improve cryoprotection
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionYP_056770.1
Spec:Entrez GeneID2932970
Spec:SwissProtIDQ6A601
NCBI ReferenceYP_056770.1
Aliases /SynonymsLIPASE, triacylglycerol lipase precursor
ReferencePX-P1121
NoteFor research use only

Description of Lipase Protein/ Propionibacterium Acnes LIPASE Recombinant Protein

General information on Lipase Protein:

Propionibacterium acnes lipase is a protein secreted by the Propionibacterium acnes which is a gram-positive anaerobic bacterium. This lipase protein metabolizes sebum which in turn results into metabolites that are responsible for the human skin condition known as acne vulgaris. It is also believed that lipase overexpression increases follicular development.
Propionibacterium acnes lipase protein acts on triglycerides to release free fatty acids. Among the fatty acids released, Palmitic acid stimulates the toll-like receptor 2-mediated inflammasome. The latter is associated with the release of interleukin-1, Th17 differenciation and interleukin-17-mediated keratinocyte proliferation. Oleic acid, another fatty acid released stimulates adhesion and keratinocyte proliferation in Propionibacterium acnes, also via the release of interleukin-1.
Antifugal drug ketoconazole has been suggested to inhibit P.acnes lipase activity. However, the mechanism by which ketoconazole inhibits P.acnes lipase protein remains unknown.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Inactive pancreatic lipase-related protein 1(PNLIPRP1)
Receptor

Inactive pancreatic lipase-related protein 1(PNLIPRP1)

PX-P4626 210€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products