Leishmania P74 Recombinant Protein

Reference:
Origin Species

Brand

Product type

Host Species

Description of Leishmania P74 Recombinant Protein

Product nameLeishmania P74 Recombinant Protein
Uniprot IDA4HX73
Uniprot linkhttp://www.uniprot.org/uniprot/A4HX73
Origin speciesLeishmania
SequenceMAHNHRHKHKLMGKDKVHMNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERER GITIDIALWKFESPKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMV VCCNKMDDKTVTYAQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIERSDNMPWYKGPTLLDALDMLEPPVRP VDKPLRLPLQDVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEMHHEQLAEAQPGDNVGFNVKNVSVKDIR RGNVCGNSKNDPPKEAADFTAQVIVLNHPGQISNGYAPVLDCHTSHIACRFAEIESKIDRRSGKELEKNPKAIKSGDAAI VKMVPQKPMCVEVFNDYAPLGRFAVRDMRQTVAVGIIKGVNKKEGSGGKVTKAAAKAAKK
Molecular weight50,44 kDa
Protein delivered with Tag?Yes
Purity estimated0.8
BufferPBS, imidazole 300mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Spec:Entrez GeneID10966098
Spec:SwissProtIDA4HX73
NCBI ReferenceXP_001464664.1
ReferencePX-P1135
Clear
OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us