Leishmania CPACter Recombinant Protein

Reference:
Size

10ug, 100ug

Brand

Product type

Host Species

Product nameLeishmania CPACter Recombinant Protein
Uniprot IDQ9BIE1
Uniprot linkhttp://www.uniprot.org/uniprot/Q9BIE1
Origin speciesLeishmania
Expression systemProcaryotic expression
SequenceMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRDPSGVMSVDWREKGVVTPVKNQGMCGSCWAFATTGNIEGQWALKNHSL VSLSEQVLVSCDNIDDGCNGGLMEQAMQWIINDHNGTVPTEDSYPYTSAGGTRPPCHDNGTVGAKIAGYMSLPHDEEEIA AYVGKNGPVAVAVDATTWQLYFGGVVTLCFGLSLNHGVLVVGFNRQAKPPYWIVKNSWGSSWGEKGYIRLAMGSNQCLLK NYAVTATIDDSNTSHVPTTAA
Molecular weight27,85 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 300mM
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionAAK27384.1
Spec:Entrez GeneID13386130
Spec:SwissProtIDQ9BIE1
NCBI ReferenceAAK27384.1
Aliases /SynonymsCPACter (E. coli optimized), Cysteine Peptidase A C-terminal region,Cysteine proteinase-like protein
ReferencePX-P1064
NoteFor research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Leishmania CPACter Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.