Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

LCMV Glycoprotein GP2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Lymphocytic choriomeningitis virus (LCMV)
Uniprot ID:
P09991

Original price was: €264.00.Current price is: €228.00.

50ug 14% OFF + 228 loyalty points
His Gly266–Asp438
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

LCMV Glycoprotein GP2, N-His

Product name ARO-P18072-100
Uniprot ID P09991
Origin species Lymphocytic choriomeningitis virus (LCMV)
Expression system Prokaryotic expression
Raw Antigen Sequence GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMD
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly266-Asp438
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18072
Note For research use only.
Molecular Constructor
His Gly266–Asp438
Product name ARO-P18072-1MG
Uniprot ID P09991
Origin species Lymphocytic choriomeningitis virus (LCMV)
Expression system Prokaryotic expression
Raw Antigen Sequence GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMD
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly266-Asp438
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18072
Note For research use only.
Molecular Constructor
His Gly266–Asp438
Product name ARO-P18072-50
Uniprot ID P09991
Origin species Lymphocytic choriomeningitis virus (LCMV)
Expression system Prokaryotic expression
Raw Antigen Sequence GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMD
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly266-Asp438
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18072
Note For research use only.
Molecular Constructor
His Gly266–Asp438

SDS-PAGE for LCMV Glycoprotein GP2, N-His

SDS-PAGE for LCMV Glycoprotein GP2, N-His

LCMV Glycoprotein GP2, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “LCMV Glycoprotein GP2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products