Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

JUNV Glycoprotein GP1, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Junin mammarenavirus (JUNV)
Uniprot ID:
P26313

Original price was: €260.00.Current price is: €228.00.

50ug 12% OFF + 228 loyalty points
His Glu59–Leu250
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

JUNV Glycoprotein GP1, N-His

Product name ARO-P18073-100
Uniprot ID P26313
Origin species Junin mammarenavirus (JUNV)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSL
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu59-Leu250
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18073
Note For research use only.
Molecular Constructor
His Glu59–Leu250
Product name ARO-P18073-1MG
Uniprot ID P26313
Origin species Junin mammarenavirus (JUNV)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSL
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu59-Leu250
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18073
Note For research use only.
Molecular Constructor
His Glu59–Leu250
Product name ARO-P18073-50
Uniprot ID P26313
Origin species Junin mammarenavirus (JUNV)
Expression system Prokaryotic expression
Raw Antigen Sequence EEAFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFKISFDDIAVLLPEYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWYLDPPFLCRNRTKTEGFIFQVNTSKTGINENYAKKFKTGMHHLYREYPDSCLDGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRGKNIQLPRRSL
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu59-Leu250
Aliases /Synonyms Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Stable signal peptide, SSP, Glycoprotein G1, GP1, Glycoprotein G2, GP2, GPC
Reference ARO-P18073
Note For research use only.
Molecular Constructor
His Glu59–Leu250

SDS-PAGE for JUNV Glycoprotein GP1, N-His

SDS-PAGE for JUNV Glycoprotein GP1, N-His

JUNV Glycoprotein GP1, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “JUNV Glycoprotein GP1, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products