Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P36956-3
Molecular weight:
50.2kDa

Original price was: €235.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
His Met1–Leu466
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

Product name Isoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only
Molecular Constructor
His Met1–Leu466
Product name Isoform SREBP-1C of Sterol regulatory element-binding protein 1
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only
Molecular Constructor
His Met1–Leu466
Product name PX-P4844-1MG
Uniprot ID P36956-3
Uniprot link https://www.uniprot.org/uniprot/P36956-3
Expression system Prokaryotic expression
Raw Antigen Sequence MDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTEVEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSRGMLDRSRLAL
Molecular weight 50.2kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >10% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Leu466
Protein Accession P36956
Spec:Entrez GeneID 6720
Spec:NCBI Gene Aliases HMD; IFAP2; SREBP1; bHLHd1
Spec:SwissProtID Q16062
NCBI Reference P36956.2
Aliases /Synonyms SREBP-1,Class D basic helix-loop-helix protein 1,bHLHd1,Sterol regulatory element-binding transcription factor 1,BHLHD1, SREBP1
Reference PX-P4844
Note For research use only.
Molecular Constructor
His Met1–Leu466

Isoform SREBP-1C of Sterol regulatory element-binding protein 1

There are no reviews yet.

Be the first to review “Isoform SREBP-1C of Sterol regulatory element-binding protein 1”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products