Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)

Clonality:
Monoclonal Antibody
Host species:
Human

Original price was: €472.00.Current price is: €366.00.

100ug 22% OFF + 366 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)

InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)

Product name ARO-A13286-100
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A13286
Clonality Monoclonal Antibody
Protein Name IP-9
Product name ARO-A13286-1MG
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A13286
Clonality Monoclonal Antibody
Protein Name IP-9
Product name ARO-A13286-50
Uniprot ID O14625
Raw Antigen Sequence MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-IP-9, I-TAC, C-X-C motif chemokine 11, ITAC, Small-inducible cytokine B11, SCYB11, Beta-R1, Interferon gamma-inducible protein 9, H174, SCYB9B, CXCL11, Interferon-inducible T-cell alpha chemoattractant
Reference ARO-A13286
Clonality Monoclonal Antibody
Protein Name IP-9

SDS-PAGE for InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)

SDS-PAGE for InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)

InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CXCL11/I-TAC (Iv0089)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products