Brand: ProteoGenix

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

ARO-A13287-50
Validated ELISA WB

Clonality:: Monoclonal Antibody
Host species:: Human

Original price was: €317.00.Current price is: €256.00.

50ug 19% OFF + 256 loyalty points

Size Size

50ug Original price was: €317.00.Current price is: €256.00.
100ug Original price was: €509.00.Current price is: €366.00.
1MG Original price was: €1,273.00.Current price is: €1,061.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) binds to Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His in WB Assay

Datasheet

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

Product name	ARO-A13287-100
Uniprot ID	P02778
Raw Antigen Sequence	MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference	ARO-A13287
Clonality	Monoclonal Antibody
Protein Name	Gamma-IP10

Product name	ARO-A13287-1MG
Uniprot ID	P02778
Raw Antigen Sequence	MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference	ARO-A13287
Clonality	Monoclonal Antibody
Protein Name	Gamma-IP10

Product name	ARO-A13287-50
Uniprot ID	P02778
Raw Antigen Sequence	MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Gamma-IP10, C-X-C motif chemokine 10, INP10, 10 kDa interferon gamma-induced protein, Small-inducible cytokine B10, SCYB10, IP-10, CXCL10
Reference	ARO-A13287
Clonality	Monoclonal Antibody
Protein Name	Gamma-IP10

Datasheet

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) binds to Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His in WB Assay

Human CXCL10/IP-10 Recombinant Protein, N-GST & C-His(cat. No.ARO-P21254) can bind InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)

InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human CXCL10/IP-10 (Iv0088)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *