Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A)

  • ARO-A13126-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Host species:
Mouse

Original price was: €328.00.Current price is: €256.00.

50ug 22% OFF + 256 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A)

Product name ARO-A13126-100
Uniprot ID Q15661
Raw Antigen Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TPSB1, TPS2, Tryptase I, Tryptase-1, TPSAB1, Tryptase alpha-1, Tryptase alpha/beta-1, TPS1
Reference ARO-A13126
Clonality Monoclonal Antibody
Protein Name TPSB1
Product name ARO-A13126-1MG
Uniprot ID Q15661
Raw Antigen Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TPSB1, TPS2, Tryptase I, Tryptase-1, TPSAB1, Tryptase alpha-1, Tryptase alpha/beta-1, TPS1
Reference ARO-A13126
Clonality Monoclonal Antibody
Protein Name TPSB1
Product name ARO-A13126-50
Uniprot ID Q15661
Raw Antigen Sequence MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Mouse
Aliases /Synonyms Anti-TPSB1, TPS2, Tryptase I, Tryptase-1, TPSAB1, Tryptase alpha-1, Tryptase alpha/beta-1, TPS1
Reference ARO-A13126
Clonality Monoclonal Antibody
Protein Name TPSB1

InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A) binds to Recombinant Human TPSAB1/Tryptase-1, N-His in WB Assay

InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A) binds to Recombinant Human TPSAB1/Tryptase-1, N-His in WB Assay

Recombinant Human TPSAB1/Tryptase-1, N-His(cat. No.ARO-P13357) can bind InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A) in Western Blot Assay as detected on gel analysis.

SDS-PAGE for InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A)

SDS-PAGE for InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A)

InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “InVivoMAb Anti-Human β-tryptase/TPSAB1 Antibody (31A)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products